SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene122684

Length: 427 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v3.0_unigene122684
AAGGAGCTTACGTGAGATATATGCACAAGACCAATCAGCTGCTAGAAATGGTCTTGTGGGGGATAATTCTGATCTGCAAAGGACTAGCTCAGAGTTTATTGAGCCTCCTCTTGTCCACACTGCTACTGAACCATCACCATCCTGGCATTGTCATTTGGTTCAGTCTTCCGATCCACAGTCTTATGCTGAGGCTACTGGGCATCCAGCTTGGGAATCTGCCATGGAGGAGGAGTATAACTCCCTCATCGAGAACCAGACTTGGGATCCGGTCCCCTTCCTTCAGGAAGGAAACTTGTCCGATGCAAATGGGTCTACAAGACCAAGAGTGCTGCAAATGGACAAATCACCAGACGGAAAGCAAGGCTAGTAGCTAAAGGCTTCCAACAAGTGCATGGCATTGATTATGACGAGACCTTTGCTCCCCCAT

Ace file of the UniGene sp_v3.0_unigene122684 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	PREDICTED: similar to pol polyprotein, partial n=1 Tax=Nasonia vitripennis RepID=UPI00015B4525	-	-	7.0e-19	58%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	60%

Source	Gene names
Sma3	LOC_Os10g29650; LOC_Os11g44780; OSJNBa0088I22.18; OSJNBb0067H15.15; Os04g0621600; Os05g0214700; Os08g0384400; Os09g0131600; P0605G01.12; VITISV_000584; VITISV_006541; VITISV_006799; VITISV_007267; VITISV_009286; VITISV_010143; VITISV_010987; VITISV_011263

Source	GOs	Term	Type	Identity
Sma3	nucleic acid binding	GO:0003676	Molecular Function	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	zinc ion binding	GO:0008270	Molecular Function	-
Sma3	electron carrier activity	GO:0009055	Molecular Function	-
Sma3	oxidoreductase activity	GO:0016491	Molecular Function	-
Sma3	ATPase activity	GO:0016887	Molecular Function	-
Sma3	nucleoside-triphosphatase activity	GO:0017111	Molecular Function	-
Sma3	iron-sulfur cluster binding	GO:0051536	Molecular Function	-
Sma3	apoptotic process	GO:0006915	Biological Process	-
Sma3	defense response	GO:0006952	Biological Process	-
Sma3	DNA integration	GO:0015074	Biological Process	-
Sma3	oxidation-reduction process	GO:0055114	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding domain	IPR000194	-	-
Sma3	Peptidase S8/S53, subtilisin/kexin/sedolisin	IPR000209	-	-
Sma3	Peptidase M14, carboxypeptidase A	IPR000834	-	-
Sma3	4Fe-4S binding domain	IPR001450	-	-
Sma3	Integrase, catalytic core	IPR001584	-	-
Sma3	Zinc finger, CCHC-type	IPR001878	-	-
Sma3	NB-ARC	IPR002182	-	-
Sma3	ABC transporter-like	IPR003439	-	-
Sma3	AAA+ ATPase domain	IPR003593	-	-
Sma3	Retrotransposon gag protein	IPR005162	-	-
Sma3	Sugar transporter, conserved site	IPR005829	-	-
Sma3	Uncharacterised protein family Cys-rich	IPR006461	-	-
Sma3	RNase L inhibitor RLI, possible metal-binding domain	IPR007209	-	-
Sma3		IPR013084	-	-
Sma3	Reverse transcriptase, RNA-dependent DNA polymerase	IPR013103	-	-
Sma3	Alcohol dehydrogenase, C-terminal	IPR013149	-	-
Sma3	ABC transporter, ABCE	IPR013283	-	-
Sma3	NAD(P)-binding domain	IPR016040	-	-
Sma3	ABC transporter, conserved site	IPR017871	-	-
Sma3	4Fe-4S ferredoxin-type, iron-sulpur binding domain	IPR017896	-	-
Sma3	4Fe-4S ferredoxin, iron-sulphur binding, conserved site	IPR017900	-	-
Sma3	Heat shock protein DnaJ, conserved site	IPR018253	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	ATMG00820.1	ORF170 Reverse transcriptase (RNA-dependent DNA polymerase) chrM:228573-229085 REVERSE LENGTH=170	2.0e-13	50%
RefSeq	Arabidopsis thaliana	NP_085538.1	hypothetical protein ArthMp071 (mitochondrion) [Arabidopsis thaliana]	2.0e-13	50%

Full-Lengther Next Prediction

Fln status: Putative N-terminus

Fln database: coniferopsida.fasta

Fln subject: B8LKV8

Fln msg: Distance to subject end: 294 aas, Unexpected STOP codon in 5 prime region, your sequence is shorter than subject: 63 - 363

Fln protein: LPHREPDLGSGPLPSGRKLVRCKWVYKTKSAANGQITRRKARLVAKGFQQVHGIDYDETFAPP

Protein Length: 64

Fln nts: AAGGAGCTTACGTGAGATATATGCACAAGACCAATCAGCTGCTAGAAATGGTCTTGTGGGGGATAATTCTGATCTGCAAAGGACTAGCTCAGAGTTTATTGAGCCTCCTCTTGTCCACACTGCTACTGAACCATCACCATCCTGGCATTGTCATTTGGTTCAGTCTTCCGATCCACAGTCTTATGCTGAGGCTACTGGGCATCCAGCTTGGGAATCTGCCATGGAGGAGGAGTATAACTCCCTCATCGAGAACCAGACTTGGGATCCGGTCCCCTTCCTTCAGGAAGGAAACTTGTCCGATGCAAATGGGTCTACAAGACCAAGAGTGCTGCAAATGGACAAATCACCAGACGGAAAGCAAGGCTAGTAGCTAAAGGCTTCCAACAAGTGCATGGCATTGATTATGACGAGACCTTTGCTCCCCCAT

Fln Alignment:

AllPine_a_c58923___LPSGRKLVRCKWVYKTKSAANGQITRRKARLVAKGFQQVHGIDYDETFAP
B8LKV8________________LPKEKECISVKWVYKTKYKANGELDKHKARLVAKGFAQEYGVDYNETFAP

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain