UniGene Name: sp_v3.0_unigene122607
Length: 241 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene122607
C |
Ace file of the UniGene sp_v3.0_unigene122607
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family protein [Arabidopsis thaliana] gb|AAD32878.1|AC005489_16 F14N23.16 [Arabidopsis thaliana] gb|ABK32109.1| At1g10280 [Arabidopsis thaliana] gb|AEE28561.1| Core-2/I-branching beta-1,6-N-acety | - | - | 4.0e-28 | 67% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 81% |
| Source | Gene names |
|---|---|
| Sma3 | At1g10280; At1g10880; At1g51770; At5g11730; At5g25970; F19C24.28; GSVIVT00017713001; GSVIVT00017714001; GSVIVT00017715001; GSVIVT00030375001; GSVIVT00030378001; GSVIVT00032153001; GSVIVT00034221001; GSVIVT00035335001; GSVIVT00038249001; LOC_Os03g52120; Mt |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G10280.1 | Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family protein chr1:3366795-3368739 REVERSE LENGTH=412 | 9.0e-36 | 67% |
| RefSeq | Arabidopsis thaliana | NP_172499.1 | Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family protein [Arabidopsis thaliana] | 1.0e-35 | 67% |
| RefSeq | Populus trichocarpa | XP_002331082.1 | predicted protein [Populus trichocarpa] | 2.0e-36 | 71% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AB94
Fln msg: Distance to subject end: 63 aas, your sequence is shorter than subject: 80 - 345
Fln protein:
R
Protein Length:
81
Fln nts:
C
Fln Alignment:
AllPine_a_c58837___RYRRKMAPDVTLRQWRKGSQWFEIHRKLAINIISDTKYYAIFKAFCTPSCYVDEHYLPTILNMKFGSLNSNRSITWL
D5AB94________________RYNIKMAPEVTLSQWRKGSQWFEVHRKLAIDIISDTKYYQIFKAFCKPSCYIDEHYIPTILSMQFGSLISNRSITWV

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta