SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene122377

Length: 191 nt

UniGene Fasta

>sp_v3.0_unigene122377
GCTGGAGACATTGATATCGTCAGAAGACGAAAGCTGTGGCCAGCCCCTCACAGACGATCAGATTGCAGATAATATCATTGGAGTTATTTTCGCAGCTCAGGATACAACGGCCAGTGTCTTGACATGGATCCTCAAATACCTCAGAGATCATGCCGAACTTCTCGAAGCCGTGACGGCTGAGCAGGAGGCTA

Ace file of the UniGene sp_v3.0_unigene122377

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	putative cytochrome P450 [Oryza sativa Japonica Group]	-	-	3.0e-15	68%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	95%
Sma3	ABA 8-oxidase	-	-	1.054e-14	-

Source	ECs	Term	Type	e value	Identity
Sma3	Ent-kaurenoic acid oxidase.	EC:1.14.13.79	-	2.501e-11	-

Source	KEGGs	Term	Type	e value	Identity
Sma3	Diterpenoid biosynthesis	00904		2.501e-11	%
Sma3	Biosynthesis of terpenoids and steroids	01062		2.501e-11	%
Sma3	Biosynthesis of plant hormones	01070		2.501e-11	%
Sma3	Metabolic pathways	01100		2.501e-11	%
Sma3	Biosynthesis of secondary metabolites	01110		2.501e-11	%
Sma3	(+)-abscisic acid 8'-hydroxylase.	EC:1.14.13.93	-	4.092e-23	-

Source	KEGGs	Term	Type	e value	Identity
Sma3	Carotenoid biosynthesis	00906		4.092e-23	%

Source	Gene names
Sma3	ABA8OX1; ABA8OX2; ABA8OX3; At2g29090; At3g19270; At4g19230; At5g45340; CYP707A1; CYP707A10; CYP707A12v1; CYP707A13; CYP707A14; CYP707A16; CYP707A17; CYP707A2; CYP707A3; CYP707A4; CYP707A5; CYP707A6; CYP707A7; Cytp450-1; GSVIVT00001184001; GSVIVT0001481800

Source	GOs	Term	Type	Identity
Sma3	endoplasmic reticulum membrane	GO:0005789	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	monooxygenase activity	GO:0004497	Molecular Function	-
Sma3	iron ion binding	GO:0005506	Molecular Function	-
Sma3	electron carrier activity	GO:0009055	Molecular Function	-
Sma3	(+)-abscisic acid 8'-hydroxylase activity	GO:0010295	Molecular Function	-
Sma3	heme binding	GO:0020037	Molecular Function	-
Sma3	response to stress	GO:0006950	Biological Process	-
Sma3	response to water deprivation	GO:0009414	Biological Process	-
Sma3	response to red or far red light	GO:0009639	Biological Process	-
Sma3	abscisic acid metabolic process	GO:0009687	Biological Process	-
Sma3	response to red light	GO:0010114	Biological Process	-
Sma3	abscisic acid catabolic process	GO:0046345	Biological Process	-
Sma3	release of seed from dormancy	GO:0048838	Biological Process	-
Sma3	oxidation-reduction process	GO:0055114	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Cytochrome P450	IPR001128	-	-
Sma3	Cytochrome P450, E-class, group I	IPR002401	-	-
Sma3	Cytochrome P450, E-class, group IV	IPR002403	-	-
Sma3	Cytochrome P450, conserved site	IPR017972	-	-
Sma3		IPR017973	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT3G19270.1	CYP707A4 cytochrome P450, family 707, subfamily A, polypeptide 4 chr3:6673885-6676400 REVERSE LENGTH=468	2.0e-18	76%
RefSeq	Arabidopsis thaliana	NP_566628.1	abscisic acid 8'-hydroxylase 4 [Arabidopsis thaliana]	3.0e-18	76%
RefSeq	Populus trichocarpa	XP_002327141.1	cytochrome P450 [Populus trichocarpa]	2.0e-20	66%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: D5AC99

Fln msg: Distance to subject end: 166 aas, your sequence is shorter than subject: 63 - 270

Fln protein: LETLISSEDESCGQPLTDDQIADNIIGVIFAAQDTTASVLTWILKYLRDHAELLEAVTAEQEA

Protein Length: 64

Fln nts: GCTGGAGACATTGATATCGTCAGAAGACGAAAGCTGTGGCCAGCCCCTCACAGACGATCAGATTGCAGATAATATCATTGGAGTTATTTTCGCAGCTCAGGATACAACGGCCAGTGTCTTGACATGGATCCTCAAATACCTCAGAGATCATGCCGAACTTCTCGAAGCCGTGACGGCTGAGCAGGAGGCTA

Fln Alignment:

AllPine_a_c58546___LETLISSEDESCGQPLTDDQIADNIIGVIFAAQDTTASVLTWILKYLRDHAELLEAVTAEQEA
D5AC99________________LETLMSSEEESCGQPLTYDQIADNIIGVIFAAQDTTASVLTWILKYLRDHAELLEAVTAEQEA

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain