UniGene Name: sp_v3.0_unigene122377
Length: 191 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene122377
G |
Ace file of the UniGene sp_v3.0_unigene122377
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | putative cytochrome P450 [Oryza sativa Japonica Group] | - | - | 3.0e-15 | 68% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 95% |
| Sma3 | ABA 8-oxidase | - | - | 1.054e-14 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ent-kaurenoic acid oxidase. | EC:1.14.13.79 | - | 2.501e-11 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Diterpenoid biosynthesis | 00904 | 2.501e-11 | % | |
| Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 2.501e-11 | % | |
| Sma3 | Biosynthesis of plant hormones | 01070 | 2.501e-11 | % | |
| Sma3 | Metabolic pathways | 01100 | 2.501e-11 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 2.501e-11 | % | |
| Sma3 | (+)-abscisic acid 8'-hydroxylase. | EC:1.14.13.93 | - | 4.092e-23 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Carotenoid biosynthesis | 00906 | 4.092e-23 | % |
| Source | Gene names |
|---|---|
| Sma3 | ABA8OX1; ABA8OX2; ABA8OX3; At2g29090; At3g19270; At4g19230; At5g45340; CYP707A1; CYP707A10; CYP707A12v1; CYP707A13; CYP707A14; CYP707A16; CYP707A17; CYP707A2; CYP707A3; CYP707A4; CYP707A5; CYP707A6; CYP707A7; Cytp450-1; GSVIVT00001184001; GSVIVT0001481800 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | endoplasmic reticulum membrane | GO:0005789 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | (+)-abscisic acid 8'-hydroxylase activity | GO:0010295 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | response to stress | GO:0006950 | Biological Process | 0.0 | - |
| Sma3 | response to water deprivation | GO:0009414 | Biological Process | 0.0 | - |
| Sma3 | response to red or far red light | GO:0009639 | Biological Process | 0.0 | - |
| Sma3 | abscisic acid metabolic process | GO:0009687 | Biological Process | 0.0 | - |
| Sma3 | response to red light | GO:0010114 | Biological Process | 0.0 | - |
| Sma3 | abscisic acid catabolic process | GO:0046345 | Biological Process | 0.0 | - |
| Sma3 | release of seed from dormancy | GO:0048838 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cytochrome P450 | IPR001128 | - | 0.0 | - |
| Sma3 | Cytochrome P450, E-class, group I | IPR002401 | - | 0.0 | - |
| Sma3 | Cytochrome P450, E-class, group IV | IPR002403 | - | 0.0 | - |
| Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
| Sma3 | IPR017973 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G19270.1 | CYP707A4 cytochrome P450, family 707, subfamily A, polypeptide 4 chr3:6673885-6676400 REVERSE LENGTH=468 | 2.0e-18 | 76% |
| RefSeq | Arabidopsis thaliana | NP_566628.1 | abscisic acid 8'-hydroxylase 4 [Arabidopsis thaliana] | 3.0e-18 | 76% |
| RefSeq | Populus trichocarpa | XP_002327141.1 | cytochrome P450 [Populus trichocarpa] | 2.0e-20 | 66% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AC99
Fln msg: Distance to subject end: 166 aas, your sequence is shorter than subject: 63 - 270
Fln protein:
L
Protein Length:
64
Fln nts:
G
Fln Alignment:
AllPine_a_c58546___LETLISSEDESCGQPLTDDQIADNIIGVIFAAQDTTASVLTWILKYLRDHAELLEAVTAEQEA
D5AC99________________LETLMSSEEESCGQPLTYDQIADNIIGVIFAAQDTTASVLTWILKYLRDHAELLEAVTAEQEA

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta