UniGene Name: sp_v3.0_unigene122169
Length: 246 nt
UniGene Fasta |
---|
>sp_v3.0_unigene122169
G |
Ace file of the UniGene sp_v3.0_unigene122169 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Myosin XI, putative n=1 Tax=Ricinus communis RepID=B9S596_RICCO | - | - | 6.0e-35 | 91% |
FL-Next | tr=Myosin XI, putative; Ricinus communis (Castor bean). | - | - | 0.0 | 91% |
Sma3 | Myosin | - | - | 1.368e-24 | - |
Source | Gene names |
---|---|
Sma3 | AT4g28710; AT4g33200; ATM; At1g17580; At1g50360; At2g20290; At2g31900; At2g33240; At3g19960; At3g58160; At4g33200; At5g20490; At5g43900; At5g54280; CHLREDRAFT_113760; CHLREDRAFT_119317; CHLREDRAFT_185104; F14I3.6; F16A16.180; F20D22.7; F4I10.130; F8D11.8; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chromosome | GO:0005694 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | cell plate | GO:0009504 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | myosin complex | GO:0016459 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | motor activity | GO:0003774 | Molecular Function | 0.0 | - |
Sma3 | actin binding | GO:0003779 | Molecular Function | 0.0 | - |
Sma3 | DNA topoisomerase type I activity | GO:0003917 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | signal transducer activity | GO:0004871 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | actin filament binding | GO:0051015 | Molecular Function | 0.0 | - |
Sma3 | DNA topological change | GO:0006265 | Biological Process | 0.0 | - |
Sma3 | DNA unwinding involved in replication | GO:0006268 | Biological Process | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | signal transduction | GO:0007165 | Biological Process | 0.0 | - |
Sma3 | actin filament-based movement | GO:0030048 | Biological Process | 0.0 | - |
Sma3 | keratinization | GO:0031424 | Biological Process | 0.0 | - |
Sma3 | GO:0045449 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G43900.3 | MYA2 myosin 2 chr5:17657241-17667413 REVERSE LENGTH=1565 | 6.00036e-42 | 90% |
RefSeq | Arabidopsis thaliana | NP_199203.1 | myosin 2 [Arabidopsis thaliana] | 8.00001e-42 | 90% |
RefSeq | Populus trichocarpa | XP_002303100.1 | predicted protein [Populus trichocarpa] | 8.00001e-42 | 89% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: tr_plants
Fln subject: B9S596
Fln msg: Distance to subject end: 1132 aas, your sequence is shorter than subject: 82 - 1350
Fln protein:
A
Protein Length:
83
Fln nts:
G
Fln Alignment:
AllPine_a_c58295___AVADAAYRVMINDGISQAILVSGESGAGKTESTKMLMRYLAYMGGRGVTEGRSVEQQVLESNPVLEAFGNAKTVRNNNSSRF
B9S596________________AVADAAYRLMINEGISQSILVSGESGAGKTESTKLLMRYLAYMGGRAVAEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain