UniGene Name: sp_v3.0_unigene121973
Length: 219 nt
UniGene Fasta |
---|
>sp_v3.0_unigene121973
A |
Ace file of the UniGene sp_v3.0_unigene121973 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Unassigned protein | - | - | 0.0 | - |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 68% |
Sma3 | Pentatricopeptide repeat-containing protein, putative | - | - | 6.26e-13 | - |
Source | Gene names |
---|---|
Sma3 | A_TM021B04.2; At1g68930; At2g01510; At2g13600; At2g22070; At2g36730; At3g49710; At4g13650; At5g27110; F13K3.13; F18A5.40; F2I9.13; GSVIVT00000138001; GSVIVT00000621001; GSVIVT00002423001; GSVIVT00003900001; GSVIVT00006853001; GSVIVT00011403001; GSVIVT0001 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | ubiquitin thiolesterase activity | GO:0004221 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
Sma3 | deaminase activity | GO:0019239 | Molecular Function | 0.0 | - |
Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
Sma3 | purine ribonucleoside monophosphate biosynthetic process | GO:0009168 | Biological Process | 0.0 | - |
Sma3 | methylation | GO:0032259 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Beta-lactamase, class-A/D | IPR000871 | - | 0.0 | - |
Sma3 | Adenosine/AMP deaminase domain | IPR001365 | - | 0.0 | - |
Sma3 | Peptidase C12, ubiquitin carboxyl-terminal hydrolase 1 | IPR001578 | - | 0.0 | - |
Sma3 | DNA methylase, N-6 adenine-specific, conserved site | IPR002052 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | Putative methylase | IPR004557 | - | 0.0 | - |
Sma3 | Domain of unknown function DUF659 | IPR007021 | - | 0.0 | - |
Sma3 | Methyltransferase small | IPR007848 | - | 0.0 | - |
Sma3 | IPR008512 | - | 0.0 | - | |
Sma3 | IPR011523 | - | 0.0 | - | |
Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G36730.1 | Pentatricopeptide repeat (PPR) superfamily protein chr2:15405068-15406573 REVERSE LENGTH=501 | 1.0e-22 | 58% |
RefSeq | Arabidopsis thaliana | NP_181211.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 1.0e-22 | 58% |
RefSeq | Populus trichocarpa | XP_002333576.1 | predicted protein [Populus trichocarpa] | 7.0e-25 | 63% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AB53
Fln msg: Distance to subject end: 37 aas, your sequence is shorter than subject: 73 - 232
Fln protein:
K
Protein Length:
74
Fln nts:
A
Fln Alignment:
AllPine_a_c58060___KHSGIRPDHITLVGVLSACSRAGLVDEGYEYFNCMSNYYNITPVMEHYCCMVDILGRAGRLEEALDIINYMPI
D5AB53________________KHSDTSPNQVTFVGVLSACCHAGLVSEGRQYFNSMSVDYHITPVMEHYCCMVDLLGRTGCLDEAHDFINKMPI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain