|
||||||
|
UniGene Name: sp_v3.0_unigene121855
Length: 117 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene121855
G |
|
Ace file of the UniGene sp_v3.0_unigene121855
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | putative ubiquitin-specific protease 15 [Oryza sativa Japonica Group] dbj|BAD37542.1| putative ubiquitin-specific protease 15 [Oryza sativa Japonica Group] | - | - | 5.0e-09 | 77% |
| FL-Next | sp=Ubiquitin carboxyl-terminal hydrolase 18; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 68% |
| Sma3 | AT2G24640 protein | - | - | 1.032e-08 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ubiquitin thiolesterase. | EC:3.1.2.15 | - | 8.274e-07 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT2G24640; At1g17110; At2g24640; F20D23.20; F25P17.6; GSVIVT00000741001; GSVIVT00011462001; GSVIVT00015116001; OJ1666_A04.24; OSJNBa0085J13.24; OSJNBb0019B14.32; Os06g0654000; Os08g0478500; Os09g0464400; OsI_23952; OsI_29613; OsI_31685; OsJ_22202; OsJ_276 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | ubiquitin thiolesterase activity | GO:0004221 | Molecular Function | 0.0 | - |
| Sma3 | ubiquitin-specific protease activity | GO:0004843 | Molecular Function | 0.0 | - |
| Sma3 | peptidase activity | GO:0008233 | Molecular Function | 0.0 | - |
| Sma3 | cysteine-type peptidase activity | GO:0008234 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
| Sma3 | cell proliferation | GO:0008283 | Biological Process | 0.0 | - |
| Sma3 | flower development | GO:0009908 | Biological Process | 0.0 | - |
| Sma3 | fruit development | GO:0010154 | Biological Process | 0.0 | - |
| Sma3 | protein deubiquitination | GO:0016579 | Biological Process | 0.0 | - |
| Sma3 | root development | GO:0048364 | Biological Process | 0.0 | - |
| Sma3 | leaf development | GO:0048366 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding domain | IPR000194 | - | 0.0 | - |
| Sma3 | Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2 | IPR001394 | - | 0.0 | - |
| Sma3 | Zinc finger, MYND-type | IPR002893 | - | 0.0 | - |
| Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
| Sma3 | Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2, conserved site | IPR018200 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G31670.1 | UBP18 ubiquitin-specific protease 18 chr4:15336007-15339506 REVERSE LENGTH=631 | 6.0e-13 | 68% |
| RefSeq | Arabidopsis thaliana | NP_194895.1 | ubiquitin carboxyl-terminal hydrolase 18 [Arabidopsis thaliana] | 8.0e-13 | 68% |
| RefSeq | Populus trichocarpa | XP_002301091.1 | predicted protein [Populus trichocarpa] | 4.0e-14 | 70% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q67XW5
Fln msg: Distance to subject end: 430 aas, your sequence is shorter than subject: 38 - 631
Fln protein:
L
Protein Length:
39
Fln nts:
G
Fln Alignment:
AllPine_a_c57915___DLHPCGLINCGNSCYANAVLQCLMFTRPIAAYLLQ
Q67XW5________________ELAPCGLMNCGNSCFANVILQCLSWTRPLVAYLLE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
