UniGene Name: sp_v3.0_unigene121782
Length: 191 nt
UniGene Fasta |
---|
>sp_v3.0_unigene121782
T |
Ace file of the UniGene sp_v3.0_unigene121782 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Potassium channel TORK1 n=1 Tax=Nicotiana tabacum RepID=Q5NT78_TOBAC | - | - | 7.0e-21 | 74% |
FL-Next | sp=Potassium channel KOR1; Oryza sativa subsp. japonica (Rice). | - | - | 0.0 | 73% |
Source | Gene names |
---|---|
Sma3 | At3g02850; At5g37500; F13E7.21; GORK; GSVIVT00016959001; GSVIVT00017882001; GSVIVT00031945001; GSVIVT00032933001; MPA22.4; OSIGBa0140O07.2; OSJNBa0027P08.8; OSJNBa0091G06.35; Os06g0250600; OsI_16050; OsI_22386; OsJ_14938; OsJ_20828; P0431E05.11; POPTRDRAF |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | ion channel activity | GO:0005216 | Molecular Function | 0.0 | - |
Sma3 | voltage-gated potassium channel activity | GO:0005249 | Molecular Function | 0.0 | - |
Sma3 | outward rectifier potassium channel activity | GO:0015271 | Molecular Function | 0.0 | - |
Sma3 | potassium ion binding | GO:0030955 | Molecular Function | 0.0 | - |
Sma3 | ion transport | GO:0006811 | Biological Process | 0.0 | - |
Sma3 | potassium ion transport | GO:0006813 | Biological Process | 0.0 | - |
Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
Sma3 | response to water deprivation | GO:0009414 | Biological Process | 0.0 | - |
Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
Sma3 | response to jasmonic acid stimulus | GO:0009753 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cyclic nucleotide-binding domain | IPR000595 | - | 0.0 | - |
Sma3 | Ankyrin repeat | IPR002110 | - | 0.0 | - |
Sma3 | Potassium channel, voltage-dependent, EAG/ELK/ERG | IPR003938 | - | 0.0 | - |
Sma3 | Ion transport | IPR005821 | - | 0.0 | - |
Sma3 | RmlC-like jelly roll fold | IPR014710 | - | 0.0 | - |
Sma3 | Ribosomal protein L22/L17, conserved site | IPR018260 | - | 0.0 | - |
Sma3 | Cyclic nucleotide-binding, conserved site | IPR018488 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G37500.1 | GORK gated outwardly-rectifying K+ channel chr5:14889758-14894883 REVERSE LENGTH=820 | 8.0e-25 | 70% |
RefSeq | Arabidopsis thaliana | NP_198566.2 | Potassium channel GORK [Arabidopsis thaliana] | 1.0e-24 | 70% |
RefSeq | Populus trichocarpa | XP_002317705.1 | predicted protein [Populus trichocarpa] | 3.0e-25 | 69% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q653P0
Fln msg: Distance to subject end: 571 aas, your sequence is shorter than subject: 63 - 858
Fln protein:
I
Protein Length:
64
Fln nts:
T
Fln Alignment:
AllPine_a_c57831___IRINYLFTRILKRISMQLYCTHIAAFIFYYLAITIPEENEGSTWVGSLSLGDYHYTHFREISL
Q653P0________________IRINYLFTRIVKLIVVELYCTHTAACIFYYLATTLPESMEGYTWIGSLQLGDYSYSHFREIDL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain