|
||||||
|
UniGene Name: sp_v3.0_unigene121686
Length: 223 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene121686
G |
|
Ace file of the UniGene sp_v3.0_unigene121686 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Tyrosine decarboxylase 1 [Arabidopsis thaliana] sp|Q8RY79.1|TYDC1_ARATH RecName: Full=Tyrosine decarboxylase 1 gb|AAL69507.1| putative tyrosine decarboxylase [Arabidopsis thaliana] gb|AAM20115.1| putative tyrosine decarboxylase [Arabidopsis thaliana] gb|A | - | - | 5.0e-17 | 73% |
| FL-Next | sp=Tyrosine decarboxylase 1; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 84% |
| Sma3 | Tryptophan decarboxylase | - | - | 4.162e-17 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Tyrosine decarboxylase. | EC:4.1.1.25 | - | 2.715e-13 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Tyrosine metabolism | 00350 | 2.715e-13 | % | |
| Sma3 | Isoquinoline alkaloid biosynthesis | 00950 | 2.715e-13 | % | |
| Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 2.715e-13 | % | |
| Sma3 | Metabolic pathways | 01100 | 2.715e-13 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 2.715e-13 | % | |
| Sma3 | Aromatic-L-amino-acid decarboxylase. | EC:4.1.1.28 | - | 8.141e-16 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Histidine metabolism | 00340 | 8.141e-16 | % | |
| Sma3 | Tyrosine metabolism | 00350 | 8.141e-16 | % | |
| Sma3 | Phenylalanine metabolism | 00360 | 8.141e-16 | % | |
| Sma3 | Tryptophan metabolism | 00380 | 8.141e-16 | % | |
| Sma3 | Indole alkaloid biosynthesis | 00901 | 8.141e-16 | % | |
| Sma3 | Isoquinoline alkaloid biosynthesis | 00950 | 8.141e-16 | % | |
| Sma3 | Betalain biosynthesis | 00965 | 8.141e-16 | % | |
| Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 8.141e-16 | % | |
| Sma3 | Metabolic pathways | 01100 | 8.141e-16 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 8.141e-16 | % |
| Source | Gene names |
|---|---|
| Sma3 | At2g20340; At4g28680; ELI5; F11A3.11; GSVIVT00028492001; LOC_Os10g26110; OJ1368_G08.14; OJ1368_G08.18; OSJNBa0050N08.21; Os07g0437500; Os08g0140300; Os08g0140500; Os10g0400500; OsI_27760; OsI_27762; OsI_33483; OsJ_24044; OsJ_25993; OsJ_25995; OsJ_31441; P |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | aromatic-L-amino-acid decarboxylase activity | GO:0004058 | Molecular Function | 0.0 | - |
| Sma3 | tyrosine decarboxylase activity | GO:0004837 | Molecular Function | 0.0 | - |
| Sma3 | carboxy-lyase activity | GO:0016831 | Molecular Function | 0.0 | - |
| Sma3 | pyridoxal phosphate binding | GO:0030170 | Molecular Function | 0.0 | - |
| Sma3 | GO:0006519 | Biological Process | 0.0 | - | |
| Sma3 | response to wounding | GO:0009611 | Biological Process | 0.0 | - |
| Sma3 | carboxylic acid metabolic process | GO:0019752 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Pyridoxal phosphate-dependent decarboxylase | IPR002129 | - | 0.0 | - |
| Sma3 | Aromatic-L-amino-acid decarboxylase | IPR010977 | - | 0.0 | - |
| Sma3 | Pyridoxal phosphate-dependent transferase, major region, subdomain 1 | IPR015421 | - | 0.0 | - |
| Sma3 | Pyridoxal phosphate-dependent transferase, major region, subdomain 2 | IPR015422 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G20340.1 | Pyridoxal phosphate (PLP)-dependent transferases superfamily protein chr2:8779804-8782490 FORWARD LENGTH=490 | 3.0e-19 | 73% |
| RefSeq | Arabidopsis thaliana | NP_849999.1 | Tyrosine decarboxylase 1 [Arabidopsis thaliana] | 4.0e-19 | 73% |
| RefSeq | Populus trichocarpa | XP_002301839.1 | predicted protein [Populus trichocarpa] | 9.0e-20 | 73% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q8RY79
Fln msg: Overlapping hits, possible frame ERROR between 59 and 56, and overlapping frame ERROR between 169 and 169, Distance to subject end: 170 aas, your sequence is shorter than subject: 74 - 490
Fln protein:
A
Protein Length:
75
Fln nts:
G
Fln Alignment:
AllPine_a_c57721___ATVGTTSSTAVDPLMELGxISQDHGMWLHVDAAYAGSACICPEYRHCLDGVELADSFNMNAHKWLLTN
Q8RY79________________ANVGTTSSTAVDPLAALGxIANSNGIWFHVDAAYAGSACICPEYRQYIDGVETADSFNMNAHKWFLTN
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
