UniGene Name: sp_v3.0_unigene121374
Length: 244 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene121374
G |
Ace file of the UniGene sp_v3.0_unigene121374
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | H0413E07.4 protein n=2 Tax=Oryza sativa RepID=Q25A78_ORYSA | - | - | 2.0e-15 | 58% |
| FL-Next | tr=Reverse transcriptase; Picea glauca (White spruce) (Pinus glauca). | - | - | 0.0 | 69% |
| Sma3 | Retrotransposon protein, putative, Ty1-copia subclass | - | - | 2.611e-24 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT4g04280; AT4g04440; AT4g10460; AT4g21360; At2g07550; At2g13930; At2g15700; At2g19840; At2g21460; F28L22.3; F7L13.40; F9K21.100; Fourf gag/pol; H0306F03.15; H0413E07.4; LOC_Os03g02500; LOC_Os03g13700; LOC_Os03g21050; LOC_Os03g24260; LOC_Os03g25890; LOC_O |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | phosphopyruvate hydratase complex | GO:0000015 | Cellular Component | 0.0 | - |
| Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | intrinsic to membrane | GO:0031224 | Cellular Component | 0.0 | - |
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | dihydrofolate reductase activity | GO:0004146 | Molecular Function | 0.0 | - |
| Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
| Sma3 | endonuclease activity | GO:0004519 | Molecular Function | 0.0 | - |
| Sma3 | exonuclease activity | GO:0004527 | Molecular Function | 0.0 | - |
| Sma3 | phosphopyruvate hydratase activity | GO:0004634 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | transmembrane signaling receptor activity | GO:0004888 | Molecular Function | 0.0 | - |
| Sma3 | ionotropic glutamate receptor activity | GO:0004970 | Molecular Function | 0.0 | - |
| Sma3 | extracellular-glutamate-gated ion channel activity | GO:0005234 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
| Sma3 | peptidase activity | GO:0008233 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity | GO:0016887 | Molecular Function | 0.0 | - |
| Sma3 | protein dimerization activity | GO:0046983 | Molecular Function | 0.0 | - |
| Sma3 | NADP binding | GO:0050661 | Molecular Function | 0.0 | - |
| Sma3 | glycolysis | GO:0006096 | Biological Process | 0.0 | - |
| Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | glycine biosynthetic process | GO:0006545 | Biological Process | 0.0 | - |
| Sma3 | apoptotic process | GO:0006915 | Biological Process | 0.0 | - |
| Sma3 | signal transduction | GO:0007165 | Biological Process | 0.0 | - |
| Sma3 | nucleotide biosynthetic process | GO:0009165 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Sma3 | transposition | GO:0032196 | Biological Process | 0.0 | - |
| Sma3 | innate immune response | GO:0045087 | Biological Process | 0.0 | - |
| Sma3 | recognition of pollen | GO:0048544 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G23160.1 | CRK8 cysteine-rich RLK (RECEPTOR-like protein kinase) 8 chr4:12129485-12134086 FORWARD LENGTH=1262 | 6.0e-15 | 62% |
| RefSeq | Arabidopsis thaliana | NP_194047.2 | cysteine-rich receptor-like protein kinase 8 [Arabidopsis thaliana] | 8.0e-15 | 62% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q9M5J7
Fln msg: Distance to subject end: 331 aas, your sequence is shorter than subject: 80 - 542
Fln protein:
I
Protein Length:
81
Fln nts:
G
Fln Alignment:
AllPine_a_c57325___IERYKARLVAKGYSQVEGIDFHEIFSPVVKXXXXXXXXXXXXXXXXXXXXXDVKTAFLHGDLNEELYMEQLEGFV
Q9M5J7________________VEKYKARLVEKGYSQVEGIEFGEIFSPVAKLTSIRFLLSIVVAFDLEVEQMDVKTTFLHGDLEEEIYMKQPEGFV

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta