UniGene Name: sp_v3.0_unigene120980
Length: 221 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene120980
C |
Ace file of the UniGene sp_v3.0_unigene120980 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Multidrug resistance-associated protein 2, 6 (Mrp2, 6), abc-transoprter, putative (Fragment) n=1 Tax=Ricinus communis RepID=B9T8Y6_RICCO | - | - | 1.0e-24 | 72% |
| FL-Next | sp=ABC transporter C family member 5; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 69% |
| Sma3 | Multidrug resistance protein ABC transporter family | - | - | 6.946e-31 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | 2-alkenal reductase. | EC:1.3.1.74 | - | 3.307e-08 | - |
| Sma3 | Xenobiotic-transporting ATPase. | EC:3.6.3.44 | - | 2.865e-22 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g04120; At3g13080; At3g13090; At3g13100; At3g21250; At3g59140; At3g60160; At3g60970; B1065G12.13; B1157F09.14; EST2; F17J16.190; F20D22.11; FeMRP3; GSVIVT00006470001; GSVIVT00006491001; GSVIVT00011051001; GSVIVT00013320001; GSVIVT00018959001; GSVIVT000 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plant-type vacuole | GO:0000325 | Cellular Component | 0.0 | - |
| Sma3 | vacuolar membrane | GO:0005774 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | sulfonylurea receptor activity | GO:0008281 | Molecular Function | 0.0 | - |
| Sma3 | xenobiotic-transporting ATPase activity | GO:0008559 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | chlorophyll catabolite transmembrane transporter activity | GO:0010290 | Molecular Function | 0.0 | - |
| Sma3 | protein disulfide oxidoreductase activity | GO:0015035 | Molecular Function | 0.0 | - |
| Sma3 | glutathione S-conjugate-exporting ATPase activity | GO:0015431 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity | GO:0016887 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity, coupled to transmembrane movement of substances | GO:0042626 | Molecular Function | 0.0 | - |
| Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
| Sma3 | response to nematode | GO:0009624 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Sma3 | cellular potassium ion homeostasis | GO:0030007 | Biological Process | 0.0 | - |
| Sma3 | cell redox homeostasis | GO:0045454 | Biological Process | 0.0 | - |
| Sma3 | response to other organism | GO:0051707 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Neuraxin/MAP1B repeat | IPR000102 | - | 0.0 | - |
| Sma3 | Aminotransferase, class V/Cysteine desulfurase | IPR000192 | - | 0.0 | - |
| Sma3 | Histidine phosphatase superfamily, clade-2 | IPR000560 | - | 0.0 | - |
| Sma3 | ABC transporter, transmembrane domain | IPR001140 | - | 0.0 | - |
| Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
| Sma3 | Glutaredoxin | IPR002109 | - | 0.0 | - |
| Sma3 | ABC transporter-like | IPR003439 | - | 0.0 | - |
| Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
| Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
| Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
| Sma3 | ABC transporter, integral membrane type 1 | IPR017940 | - | 0.0 | - |
| Sma3 | Ribosomal protein S2, conserved site | IPR018130 | - | 0.0 | - |
| Sma3 | Hemopexin/matrixin, conserved site | IPR018486 | - | 0.0 | - |
| Sma3 | Peroxidase, active site | IPR019794 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G04120.1 | ATMRP5, MRP5, ATABCC5, ABCC5 multidrug resistance-associated protein 5 chr1:1064848-1070396 REVERSE LENGTH=1514 | 1.0e-27 | 69% |
| RefSeq | Arabidopsis thaliana | NP_001184906.1 | ABC transporter C family member 5 [Arabidopsis thaliana] | 2.0e-27 | 69% |
| RefSeq | Populus trichocarpa | XP_002321253.1 | multidrug resistance protein ABC transporter family [Populus trichocarpa] | 1.0e-30 | 73% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q7GB25
Fln msg: Distance to subject end: 812 aas, your sequence is shorter than subject: 73 - 1514
Fln protein:
N
Protein Length:
74
Fln nts:
C
Fln Alignment:
AllPine_a_c56861___WDPSLEQPTLKNIHLQVRRGMRVAVCGTVGSGKSSLLSCILGEIPKISGTVNVSGSKAYVPQSPWIQSGNI
Q7GB25________________WDPFSSRPTLSGIQMKVEKGMRVAVCGTVGSGKSSFISCILGEIPKISGEVRICGTTGYVSQSAWIQSGNI

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)