UniGene Name: sp_v3.0_unigene120505
Length: 241 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene120505
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | pfam00069, Pkinase, Protein kinase domain | - | - | 1.0e-09 | 32% |
FL-Next | sp=Probable LRR receptor-like serine/threonine-protein kinase At3g47570; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 50% |
Sma3 | Leucine Rich Repeat, putative | - | - | 3.032e-21 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | 2-alkenal reductase. | EC:1.3.1.74 | - | 5.368e-20 | - |
Source | Gene names |
---|---|
Sma3 | B1047H05.12; B1047H05.53; B1307A11.7; GSVIVT00003509001; GSVIVT00014285001; GSVIVT00018756001; GSVIVT00018759001; GSVIVT00018762001; GSVIVT00018765001; GSVIVT00018766001; GSVIVT00018767001; GSVIVT00018948001; GSVIVT00021489001; GSVIVT00025178001; GSVIVT00 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | enzyme inhibitor activity | GO:0004857 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | pectinesterase activity | GO:0030599 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | cell wall modification | GO:0042545 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G47570.1 | Leucine-rich repeat protein kinase family protein chr3:17527611-17530748 FORWARD LENGTH=1010 | 1.0e-11 | 50% |
RefSeq | Arabidopsis thaliana | NP_566892.1 | putative LRR receptor-like serine/threonine-protein kinase [Arabidopsis thaliana] | 1.0e-11 | 50% |
RefSeq | Populus trichocarpa | XP_002317008.1 | predicted protein, partial [Populus trichocarpa] | 7.0e-19 | 65% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: C0LGP4
Fln msg: Distance to subject end: 244 aas, your sequence is shorter than subject: 80 - 1010
Fln protein:
E
Protein Length:
81
Fln nts:
G
Fln Alignment:
AllPine_a_c56283___HRRISYQELARATNGFSEANXXXXXXXXXXXXXXXS-DGTLLAVKVFNLQTDHVEKSFEVECKVLQKVRHRNLMRIITSC
C0LGP4________________HEKISYGDLRNATNGFSSSNMVGSGSFGTVYKALLLTEKKVVAVKVLNMQRRGAMKSFMAECESLKDIRHRNLVKLLTAC
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain