UniGene Name: sp_v3.0_unigene119924
Length: 201 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene119924
T |
Ace file of the UniGene sp_v3.0_unigene119924
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | OSJNBb0018A10.13 protein n=1 Tax=Oryza sativa RepID=Q7XMC2_ORYSA | - | - | 3.0e-17 | 66% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 59% |
| Sma3 | Chromosome chr12 scaffold_18, whole genome shotgun sequence | - | - | 3.259e-19 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT4g32300; At4g32300; B1099D03.46; B1423D04.25; F10M6.60; F8B4.10; GSVIVT00017302001; GSVIVT00018598001; GSVIVT00018599001; GSVIVT00018786001; GSVIVT00018787001; GSVIVT00018788001; GSVIVT00018795001; GSVIVT00018798001; GSVIVT00018800001; GSVIVT00018801001 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | phospholipase C activity | GO:0004629 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | lipid metabolic process | GO:0006629 | Biological Process | 0.0 | - |
| Sma3 | GO:0007242 | Biological Process | 0.0 | - | |
| Sma3 | recognition of pollen | GO:0048544 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | GPCR, rhodopsin-like, 7TM | IPR000276 | - | 0.0 | - |
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | S-locus glycoprotein | IPR000858 | - | 0.0 | - |
| Sma3 | Phospholipase C, phosphatidylinositol-specific , X domain | IPR000909 | - | 0.0 | - |
| Sma3 | Bulb-type lectin domain | IPR001480 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
| Sma3 | Aminotransferase, class-II, pyridoxal-phosphate binding site | IPR001917 | - | 0.0 | - |
| Sma3 | Thaumatin, pathogenesis-related | IPR001938 | - | 0.0 | - |
| Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
| Sma3 | PAN-1 domain | IPR003014 | - | 0.0 | - |
| Sma3 | Apple-like | IPR003609 | - | 0.0 | - |
| Sma3 | Zinc finger, C2H2 | IPR007087 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | PAN-2 domain | IPR013227 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - | |
| Sma3 | Thaumatin, conserved site | IPR017949 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G32300.1 | SD2-5 S-domain-2 5 chr4:15599970-15602435 FORWARD LENGTH=821 | 4.0e-20 | 60% |
| RefSeq | Arabidopsis thaliana | NP_194957.2 | protein S-DOMAIN-2 5 [Arabidopsis thaliana] | 6.0e-20 | 60% |
| RefSeq | Populus trichocarpa | XP_002304906.1 | predicted protein, partial [Populus trichocarpa] | 8.0e-22 | 62% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NM60
Fln msg: Distance to subject end: 158 aas, your sequence is shorter than subject: 66 - 431
Fln protein:
D
Protein Length:
67
Fln nts:
T
Fln Alignment:
AllPine_a_c55548___DWRKRYKIIHDMAWGLAFLHDKSRDRILHLDVKPQNILLDENFGAKLADFGLAKLMDR-AQSHAFT
A9NM60________________DWKTRYSIALDTARGLAYLHEESRLCILHLDVKPQNILVDEYFKAKVSDFGMARCLKRDIESHLVT

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta