SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene119811

Length: 339 nt

UniGene Fasta

>sp_v3.0_unigene119811
GTAAAGCCAGACGACATTACATTTGTCGGTGTGCTCTTCGCATGTAGCCATGTAGGCGTCGTGACCTTGGCTGTCACTACTTCGATTCAATGAGTAGAGAGTATGGCATCTCACCAACAATGGAACATTATGCCTGCATTGTTGATCTTCTTGGACGTGCAGGACACTTGGACAAGGCTGAGGCTTGCATAAACAACATGCCATTTGAACCCAGTGCTTTAGTTTGGCAAACTTTACTTGGTGCATGCAAAATCCATGGTAACACAGAGATGGGCAAACGTGTGGCAGATCGTTTATTAGAGCTGGAACCCCAAGACTCTGCAACATATGTTCTTCTGT

Ace file of the UniGene sp_v3.0_unigene119811

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Tetratricopeptide-like helical n=1 Tax=Medicago truncatula RepID=Q1SN04_MEDTR	-	-	1.0e-29	54%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	58%
Sma3	Putative pentatricopeptide (PPR) repeat-containing protein	-	-	4.248e-07	-

Source	Gene names
Sma3	At1g74600; At2g13600; At3g49170; At4g02750; At4g13650; At4g33170; At5g40410; At5g48910; EMB2261; F18A5.40; F1M20.28; F2K15.30; F4I10.100; GSVIVT00000138001; GSVIVT00000293001; GSVIVT00000673001; GSVIVT00002423001; GSVIVT00004379001; GSVIVT00006516001; GSV

Source	GOs	Term	Type	Identity
Sma3	mitochondrion	GO:0005739	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	nucleic acid binding	GO:0003676	Molecular Function	-
Sma3	catalytic activity	GO:0003824	Molecular Function	-
Sma3	protein serine/threonine kinase activity	GO:0004674	Molecular Function	-
Sma3	binding	GO:0005488	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	methyltransferase activity	GO:0008168	Molecular Function	-
Sma3	deaminase activity	GO:0019239	Molecular Function	-
Sma3	protein phosphorylation	GO:0006468	Biological Process	-
Sma3	purine ribonucleoside monophosphate biosynthetic process	GO:0009168	Biological Process	-
Sma3	embryo development ending in seed dormancy	GO:0009793	Biological Process	-
Sma3	methylation	GO:0032259	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Peptidase S8/S53, subtilisin/kexin/sedolisin	IPR000209	-	-
Sma3	Armadillo	IPR000225	-	-
Sma3	Protein kinase, catalytic domain	IPR000719	-	-
Sma3	Beta-lactamase, class-A/D	IPR000871	-	-
Sma3	Adenosine/AMP deaminase domain	IPR001365	-	-
Sma3	Heat shock protein DnaJ, N-terminal	IPR001623	-	-
Sma3	DNA methylase, N-6 adenine-specific, conserved site	IPR002052	-	-
Sma3	Pentatricopeptide repeat	IPR002885	-	-
Sma3	Domain of unknown function DUF221	IPR003864	-	-
Sma3	Putative methylase	IPR004557	-	-
Sma3	Phosphopantetheine attachment site	IPR006162	-	-
Sma3	Uncharacterised protein family UPF0497, trans-membrane plant	IPR006702	-	-
Sma3	Methyltransferase small	IPR007848	-	-
Sma3	Serine/threonine-protein kinase, active site	IPR008271	-	-
Sma3	Armadillo-like helical	IPR011989	-	-
Sma3	Tetratricopeptide-like helical	IPR011990	-	-
Sma3	EGF-like region, conserved site	IPR013032	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3		IPR017442	-	-
Sma3	Asp/Glu racemase, active site	IPR018187	-	-
Sma3	WD40 repeat, conserved site	IPR019775	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT4G13650.1	Pentatricopeptide repeat (PPR) superfamily protein chr4:7939611-7942898 REVERSE LENGTH=1064	6.0e-31	59%
RefSeq	Arabidopsis thaliana	NP_193101.2	pentatricopeptide repeat-containing protein [Arabidopsis thaliana]	8.0e-31	59%
RefSeq	Populus trichocarpa	XP_002329756.1	predicted protein [Populus trichocarpa]	2.0e-32	55%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: A9P0W0

Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 163 aas, your sequence is shorter than subject: 112 - 370

Fln protein: KARRHYICRCALRM*PCRRRDLGCHYFDSMSREYGISPTMEHYACIVDLLGRAGHLDKAEACINNMPFEPSALVWQTLLGACKIHGNTEMGKRVADRLLELEPQDSATYVLL

Protein Length: 113

Fln nts: GTAAAGCCAGACGACATTACATTTGTCGGTGTGCTCTTCGCATGTAGCCATGTAGGCGTCGTGACCTTGGCTGTCACTACTTCGATTCAATGAGTAGAGAGTATGGCATCTCACCAACAATGGAACATTATGCCTGCATTGTTGATCTTCTTGGACGTGCAGGACACTTGGACAAGGCTGAGGCTTGCATAAACAACATGCCATTTGAACCCAGTGCTTTAGTTTGGCAAACTTTACTTGGTGCATGCAAAATCCATGGTAACACAGAGATGGGCAAACGTGTGGCAGATCGTTTATTAGAGCTGGAACCCCAAGACTCTGCAACATATGTTCTTCTGT

Fln Alignment:

AllPine_a_c55413___DLGCHYFDSMSREYGISPTMEHYACIVDLLGRAGHLDKAEACINNMPFEPSALVWQTLLGACKIHGNTEMGKRVADRLLELEPQDSATYVLL
A9P0W0________________DEGRNYFDSMTRDHGISPKAEHYSCMVDLFGRAGCLDEALNFINQMPVEPNASVWGSLLGACRVHGNIELAERAVEQLIELTPENPGTYVLL

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain