UniGene Name: sp_v3.0_unigene119523
Length: 200 nt
![]() |
---|
>sp_v3.0_unigene119523
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Subtilisin-like protein n=1 Tax=Picea abies RepID=Q40764_PICAB | - | - | 2.0e-21 | 78% |
FL-Next | tr=Subtilisin-like protein; Picea abies (Norway spruce) (Picea excelsa). | - | - | 0.0 | 79% |
Sma3 | Chromosome chr13 scaffold_17, whole genome shotgun sequence | - | - | 7.288e-14 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cucumisin. | EC:3.4.21.25 | - | 1.209e-20 | - |
Source | Gene names |
---|---|
Sma3 | AT4g15040; AT4g34980; At1g20160; At4g34980; At5g03620; At5g58840; At5g59090; At5g59100; At5g59120; At5g59130; F17C15_40; GSVIVT00001075001; GSVIVT00010610001; GSVIVT00014361001; GSVIVT00017417001; GSVIVT00017418001; GSVIVT00018374001; GSVIVT00018380001; G |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | serine-type endopeptidase activity | GO:0004252 | Molecular Function | 0.0 | - |
Sma3 | identical protein binding | GO:0042802 | Molecular Function | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | plant-type cell wall modification | GO:0009827 | Biological Process | 0.0 | - |
Sma3 | negative regulation of catalytic activity | GO:0043086 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ornithine/DAP/Arg decarboxylase | IPR000183 | - | 0.0 | - |
Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
Sma3 | Signal recognition particle, SRP54 subunit, GTPase | IPR000897 | - | 0.0 | - |
Sma3 | SEC7-like | IPR000904 | - | 0.0 | - |
Sma3 | Protease-associated domain, PA | IPR003137 | - | 0.0 | - |
Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
Sma3 | Proteinase inhibitor I9 | IPR010259 | - | 0.0 | - |
Sma3 | Peptidase S8, subtilisin-related | IPR015500 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G20150.1 | Subtilisin-like serine endopeptidase family protein chr1:6987332-6990361 REVERSE LENGTH=780 | 1.0e-13 | 57% |
RefSeq | Arabidopsis thaliana | NP_564106.1 | Subtilisin-like serine endopeptidase-like protein [Arabidopsis thaliana] | 2.0e-13 | 57% |
RefSeq | Populus trichocarpa | XP_002300693.1 | predicted protein [Populus trichocarpa] | 2.0e-14 | 61% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q40764
Fln msg: Distance to subject end: 457 aas, your sequence is shorter than subject: 66 - 779
Fln protein:
T
Protein Length:
67
Fln nts:
A
Fln Alignment:
AllPine_a_c55032___TTRIAMYRVCGLDYGCPGVQILAAFDDAVKDGVD---XXXXXXXXNQADFVNDPIAIGAFHATHKGILV
Q40764________________STRIAMYRVCGLDYGCPGVQILAAFDDAVKDGVDIVSISIGVRSSNQADFVKDAIAIGAFHATQKGILV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain