UniGene Name: sp_v3.0_unigene119447
Length: 240 nt
UniGene Fasta |
---|
>sp_v3.0_unigene119447
A |
Ace file of the UniGene sp_v3.0_unigene119447 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Receptor protein kinase n=1 Tax=Pinus sylvestris RepID=Q9FEU2_PINSY | - | - | 7.0e-16 | 72% |
FL-Next | tr=Receptor protein kinase; Pinus sylvestris (Scots pine). | - | - | 0.0 | 72% |
Sma3 | Leucine-rich repeat receptor protein kinase EXS, putative | - | - | 2.327e-06 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | 2-alkenal reductase. | EC:1.3.1.74 | - | 8.804e-10 | - |
Sma3 | EC:2.7.11.3- | - | 1.627e-07 | - |
Source | Gene names |
---|---|
Sma3 | AT5G48940; At5g56040; GSVIVT00001242001; GSVIVT00005395001; GSVIVT00014274001; GSVIVT00016022001; GSVIVT00020456001; LRR-RLK; Os01g0170300; Os05g0169600; OsI_00573; OsI_18620; OsJ_00540; OsJ_17278; P0583G08.7; P0685E10.1; POPTRDRAFT_1078694; POPTRDRAFT_11 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
Sma3 | Carbamoyl-phosphate synthetase, large subunit, ATP-binding | IPR005479 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Leucine-rich repeat-containing N-terminal, type 2 | IPR013210 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | Aldo/keto reductase, conserved site | IPR018170 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G48940.1 | Leucine-rich repeat transmembrane protein kinase family protein chr5:19839785-19843744 FORWARD LENGTH=1135 | 8.0e-17 | 61% |
RefSeq | Arabidopsis thaliana | NP_199705.2 | LRR receptor-like serine/threonine-protein kinase RCH1 [Arabidopsis thaliana] | 1.0e-16 | 61% |
RefSeq | Populus trichocarpa | XP_002307483.1 | predicted protein [Populus trichocarpa] | 8.0e-18 | 66% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q9FEU2
Fln msg: Distance to subject end: 524 aas, your sequence is shorter than subject: 80 - 1145
Fln protein:
K
Protein Length:
81
Fln nts:
A
Fln Alignment:
AllPine_a_c54939___LRLGSLKKLQTLKLYTAELSGSIPAEIGDCVALENLYLYGNKLSGSIPRELGKLQNLTK
Q9FEU2________________LSFGSLKKLQTLAIYTAFLSGTIPAELGNCSELVNLYLYENRLSGAIPRELGKLQKLEK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain