UniGene Name: sp_v3.0_unigene119293
Length: 225 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene119293
G |
Ace file of the UniGene sp_v3.0_unigene119293
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | pfam03171, 2OG-FeII_Oxy, 2OG-Fe(II) oxygenase superfamily | - | - | 2.0e-26 | 53% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 63% |
| Sma3 | Gibberellin 20-oxidase | - | - | 2.72e-29 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Flavonol synthase. | EC:1.14.11.23 | - | 6.42e-07 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Flavonoid biosynthesis | 00941 | 6.42e-07 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 6.42e-07 | % | |
| Sma3 | Metabolic pathways | 01100 | 6.42e-07 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 6.42e-07 | % | |
| Sma3 | Flavanone 3-dioxygenase. | EC:1.14.11.9 | - | 6.957e-13 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Flavonoid biosynthesis | 00941 | 6.957e-13 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 6.957e-13 | % | |
| Sma3 | Metabolic pathways | 01100 | 6.957e-13 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 6.957e-13 | % |
| Source | Gene names |
|---|---|
| Sma3 | 20ox; 20ox2; ANS; AT4g10490; AT4g10500; At1g55290; At2g36690; At3g11180; At4g10490; At4g10500; At5g05600; At5g24530; B1331F11.1; C20ox2; CmGA20ox1; CmGA20ox2; DgGA20ox; F11B9.11; F3H; F3H-A; F3H7.16; F3H7.17; F7A10.24; F7L13.70; F7L13.80; F9F8.3; GA20; GA |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen | GO:0016702 | Molecular Function | 0.0 | - |
| Sma3 | gibberellin 3-beta-dioxygenase activity | GO:0016707 | Molecular Function | 0.0 | - |
| Sma3 | naringenin 3-dioxygenase activity | GO:0045486 | Molecular Function | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Isopenicillin N synthase | IPR002283 | - | 0.0 | - |
| Sma3 | Lipocalin | IPR002345 | - | 0.0 | - |
| Sma3 | Oxoglutarate/iron-dependent oxygenase | IPR005123 | - | 0.0 | - |
| Sma3 | Ribosomal protein S14, conserved site | IPR018271 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G36690.1 | 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein chr2:15379930-15381987 FORWARD LENGTH=366 | 2.0e-32 | 70% |
| RefSeq | Arabidopsis thaliana | NP_181207.2 | 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase-like protein [Arabidopsis thaliana] | 3.0e-32 | 70% |
| RefSeq | Populus trichocarpa | XP_002316410.1 | predicted protein [Populus trichocarpa] | 2.0e-30 | 66% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NQA3
Fln msg: Distance to subject end: 68 aas, your sequence is shorter than subject: 74 - 361
Fln protein:
P
Protein Length:
75
Fln nts:
G
Fln Alignment:
AllPine_a_c54740___PEPELTLGMPPHSDYGCLTILLQDSVGGFQLLHDGQWKAVRPLANSFIVNIGDHVEILSNGRYKSVVHRVVVNS
A9NQA3________________PEPDETMGIAPHSDHGGLTILLQNDVGGLQVRHEGRWVAVEPSPNAFVVNVSDHLEIVSNGRYKSVEHRAVVNA

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta