|
||||||
|
UniGene Name: sp_v3.0_unigene119241
Length: 214 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene119241
G |
|
Ace file of the UniGene sp_v3.0_unigene119241
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | casein kinase 1 [Arabidopsis thaliana] sp|P42158.2|KC1D_ARATH RecName: Full=Casein kinase I isoform delta-like; Short=CKI-delta emb|CAB39675.1| Col-0 casein kinase I-like protein [Arabidopsis thaliana] emb|CAB79465.1| Col-0 casein kinase I-like protein [A | - | - | 2.0e-27 | 85% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 83% |
| Sma3 | Putative casein kinase I | - | - | 7.298e-25 | - |
| Source | Gene names |
|---|---|
| Sma3 | ADK1; AT4g08800; AT4g14340; AT4g28540; AT4g28860; AT4g28880; At1g03930; At1g04440; At1g72710; At1g72710/F28P22.10; At2g19470; At3g23340; At4g08800; At4g14340; At4g26100; At4g28540; At4g28860; At4g28880; At4g28880/F16A16_10; At5g43320; At5g44100; At5g57015 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | plasmodesma | GO:0009506 | Cellular Component | 0.0 | - |
| Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | kinase activity | GO:0016301 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | response to brassinosteroid stimulus | GO:0009741 | Biological Process | 0.0 | - |
| Sma3 | unidimensional cell growth | GO:0009826 | Biological Process | 0.0 | - |
| Sma3 | auxin metabolic process | GO:0009850 | Biological Process | 0.0 | - |
| Sma3 | root development | GO:0048364 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Alpha-isopropylmalate/homocitrate synthase, conserved site | IPR002034 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G26100.1 | CK1, CKL1 casein kinase 1 chr4:13227885-13230508 REVERSE LENGTH=450 | 4.0e-35 | 85% |
| RefSeq | Arabidopsis thaliana | NP_194340.1 | casein kinase 1 [Arabidopsis thaliana] | 5.0e-35 | 85% |
| RefSeq | Populus trichocarpa | XP_002330485.1 | predicted protein [Populus trichocarpa] | 5.0e-35 | 85% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NUC1
Fln msg: Distance to subject end: 200 aas, your sequence is shorter than subject: 70 - 481
Fln protein:
L
Protein Length:
71
Fln nts:
G
Fln Alignment:
AllPine_a_c54679___LPWQGLKAATKKNKYDKISEKKMSTSIEVLCESYPSEFASYFRYCRSLCFDDKPDYAYLKRIFRDLF
A9NUC1________________LPWQGLKAGTKKQKYEKISEKKVATPIEVLCKTYPSEFASYFHYCRSLRFDDRPDYAYLKRIFRDLF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
