|
||||||
|
UniGene Name: sp_v3.0_unigene119192
Length: 186 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene119192
C |
|
Ace file of the UniGene sp_v3.0_unigene119192
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Phenylalanine ammonia-lyase n=1 Tax=Psilotum nudum RepID=Q5EP62_PSINU | - | - | 6.0e-17 | 91% |
| FL-Next | sp=Phenylalanine ammonia-lyase; Pinus massoniana. | - | - | 0.0 | 80% |
| Sma3 | Phenylalanine ammonia-lyase | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phenylalanine ammonia-lyase. | EC:4.3.1.24 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phenylalanine metabolism | 00360 | 0.0 | % | |
| Sma3 | Nitrogen metabolism | 00910 | 0.0 | % | |
| Sma3 | Phenylpropanoid biosynthesis | 00940 | 0.0 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 0.0 | % | |
| Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 0.0 | % | |
| Sma3 | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 0.0 | % | |
| Sma3 | Biosynthesis of plant hormones | 01070 | 0.0 | % | |
| Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 0.0 | % | |
| Sma3 | Transferred entry: 4.3.1.23, 4.3.1.24 and 4.3.1.25. | EC:4.3.1.5 | - | 1.97e-08 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT3G53260; At2g37040; At3g10340; At3g53260; At5g04230; B1215B07.42; DcPAL4; Dcpal1; Espal1; Espal2; Espal3; Espal4; F14P13.6; F21E1_150; GSVIVT00013922001; GSVIVT00013924001; GSVIVT00013927001; GSVIVT00013928001; GSVIVT00013930001; GSVIVT00013936001; GSVI |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | ammonia ligase activity | GO:0016211 | Molecular Function | 0.0 | - |
| Sma3 | lyase activity | GO:0016829 | Molecular Function | 0.0 | - |
| Sma3 | ammonia-lyase activity | GO:0016841 | Molecular Function | 0.0 | - |
| Sma3 | phenylalanine ammonia-lyase activity | GO:0045548 | Molecular Function | 0.0 | - |
| Sma3 | L-phenylalanine catabolic process | GO:0006559 | Biological Process | 0.0 | - |
| Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
| Sma3 | biosynthetic process | GO:0009058 | Biological Process | 0.0 | - |
| Sma3 | phenylpropanoid metabolic process | GO:0009698 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Aromatic amino acid lyase | IPR001106 | - | 0.0 | - |
| Sma3 | Short-chain dehydrogenase/reductase SDR | IPR002198 | - | 0.0 | - |
| Sma3 | Phenylalanine ammonia-lyase | IPR005922 | - | 0.0 | - |
| Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G53260.1 | PAL2, ATPAL2 phenylalanine ammonia-lyase 2 chr3:19744256-19746619 REVERSE LENGTH=717 | 2.0e-20 | 84% |
| RefSeq | Arabidopsis thaliana | NP_190894.1 | phenylalanine ammonia-lyase 2 [Arabidopsis thaliana] | 3.0e-20 | 84% |
| RefSeq | Populus trichocarpa | XP_002312013.1 | phenylalanine amonnia lyase [Populus trichocarpa] | 1.0e-20 | 84% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C5MR78
Fln msg: Distance to subject end: 378 aas, your sequence is shorter than subject: 61 - 718
Fln protein:
L
Protein Length:
62
Fln nts:
C
Fln Alignment:
AllPine_a_c54612___FCEVMQGNPEFTDHLTHRLKHHPGQFAAAAIMEHLLDGSSYMKAAA
C5MR78________________FCEVMNGKPEFTDPLTHKLKHHPGQMEAAAIMEYVLDGSSYMKHAA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
