UniGene Name: sp_v3.0_unigene118942
Length: 241 nt
UniGene Fasta |
---|
>sp_v3.0_unigene118942
C |
Ace file of the UniGene sp_v3.0_unigene118942 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative protein kinase [Arabidopsis thaliana] | - | - | 1.0e-14 | 54% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 69% |
Source | Gene names |
---|---|
Sma3 | AT4g32710; At1g56720; B1153E06.9; F25P12.84; F4D11.90; GSVIVT00000338001; GSVIVT00037801001; GSVIVT00037803001; H0114G12.5; H0313F03.21; LOC_Os10g35450; MA4_25J11.20; MZB10.4; OSJNBa0017E08.16; OSJNBa0058K23.11; Os04g0619400; Os06g0551800; Os06g0676600; O |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | S-locus glycoprotein | IPR000858 | - | 0.0 | - |
Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
Sma3 | Bulb-type lectin domain | IPR001480 | - | 0.0 | - |
Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
Sma3 | Alpha-isopropylmalate/homocitrate synthase, conserved site | IPR002034 | - | 0.0 | - |
Sma3 | Epidermal growth factor-like | IPR006210 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | PAN-2 domain | IPR013227 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G56720.1 | Protein kinase superfamily protein chr1:21263630-21265559 REVERSE LENGTH=492 | 2.0e-19 | 54% |
RefSeq | Arabidopsis thaliana | NP_564722.1 | protein kinase [Arabidopsis thaliana] | 2.0e-19 | 54% |
RefSeq | Populus trichocarpa | XP_002309629.1 | predicted protein [Populus trichocarpa] | 9.0e-20 | 51% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NM60
Fln msg: Distance to subject end: 242 aas, your sequence is shorter than subject: 79 - 431
Fln protein:
A
Protein Length:
80
Fln nts:
C
Fln Alignment:
AllPine_a_c54303___ATGSFSKEIGTGGFGKVYQGI*RMGTQVAVKRLLLNQTGHGQREFCAEIVTISSLNHSNLVTLRGMCVEGPHRILVYEF
A9NM60________________ATGGFSKEIGKGGFGTVYEGILEDDTLVAVK-CLVNESRQGQAEFCAEIGTTSSINHSNLVRLHGICVEGQHRILVYEF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain