UniGene Name: sp_v3.0_unigene118918
Length: 147 nt
![]() |
---|
>sp_v3.0_unigene118918
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | receptor-like protein kinase 1 [Glycine max] | - | - | 9.0e-16 | 83% |
FL-Next | tr=Clavata-like receptor; Picea glauca (White spruce) (Pinus glauca). | - | - | 0.0 | 61% |
Sma3 | Receptor protein kinase-like protein | - | - | 5.783e-12 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Mitogen-activated protein kinase kinase kinase. | EC:2.7.11.25 | - | 1.892e-07 | - |
Source | Gene names |
---|---|
Sma3 | AK15; AT1G75820; AT3G49670; AT4G20270; AT4G28490; AT4g20270; AT5G61480; AT5G65700; At1g75820; At3g49670; At4g20270; At4g28490; At5g61480; At5g65700; CLAVATA1; CLL1A; CLL1B; CLV1; CLV1A; CLV1B; CM0216.560.nc; F1C12.190; F21O9.180; F6H11.170; FON1; GSVIVT00 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | identical protein binding | GO:0042802 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | regulation of meristem structural organization | GO:0009934 | Biological Process | 0.0 | - |
Sma3 | regulation of meristem growth | GO:0010075 | Biological Process | 0.0 | - |
Sma3 | microsporocyte differentiation | GO:0010480 | Biological Process | 0.0 | - |
Sma3 | cell differentiation | GO:0030154 | Biological Process | 0.0 | - |
Sma3 | protein autophosphorylation | GO:0046777 | Biological Process | 0.0 | - |
Sma3 | gametophyte development | GO:0048229 | Biological Process | 0.0 | - |
Sma3 | floral organ development | GO:0048437 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
Sma3 | Enolpyruvate transferase domain | IPR001986 | - | 0.0 | - |
Sma3 | Aminotransferases, class-I, pyridoxal-phosphate-binding site | IPR004838 | - | 0.0 | - |
Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Leucine-rich repeat-containing N-terminal, type 2 | IPR013210 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | HTH domain AraC-type, conserved site | IPR018062 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G49670.1 | BAM2 Leucine-rich receptor-like protein kinase family protein chr3:18417741-18420836 FORWARD LENGTH=1002 | 3.0e-20 | 81% |
RefSeq | Arabidopsis thaliana | NP_190536.1 | receptor-like kinase BAM2 [Arabidopsis thaliana] | 3.0e-20 | 81% |
RefSeq | Populus trichocarpa | XP_002300697.1 | predicted protein [Populus trichocarpa] | 9.0e-21 | 83% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q19AV8
Fln msg: Distance to subject end: 116 aas, your sequence is shorter than subject: 48 - 998
Fln protein:
F
Protein Length:
49
Fln nts:
C
Fln Alignment:
AllPine_a_c54276___FEAHVADFGLAKFLQHSG-ASEYMSSVAGTFGYIAPEYVHTLKVDEKSD
Q19AV8________________YVAHVADFGVAKILQSCARGADSMSAIAGSYGYIAPEYAYTLKVNEKSD
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain