|
||||||
|
UniGene Name: sp_v3.0_unigene118349
Length: 177 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene118349
G |
|
Ace file of the UniGene sp_v3.0_unigene118349
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Putative sinapyl alcohol dehydrogenase (Fragment) n=1 Tax=Cathaya argyrophylla RepID=E5F5N5_9CONI | - | - | 8.0e-14 | 63% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 79% |
| Sma3 | Cinnamyl alcohol dehydrogenase | - | - | 1.031e-27 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cinnamyl-alcohol dehydrogenase. | EC:1.1.1.195 | - | 8.773e-14 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phenylpropanoid biosynthesis | 00940 | 8.773e-14 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 8.773e-14 | % | |
| Sma3 | Metabolic pathways | 01100 | 8.773e-14 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 8.773e-14 | % | |
| Sma3 | Mannitol dehydrogenase. | EC:1.1.1.255 | - | 7.478e-31 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT4G37980; At4g37980; At4g37990; BM1; CAD; CAD2; CAD7; CAD8; CADL1; CADL10; CADL4; CADL5; CADL6; CADL7; CADL8; CADL9; CHLREDRAFT_190510; ELI3; ELI3-1; ELI3-2; ELI3-BN-3; ELI3-BN-4; ELI3-BO-1; F20D10.100; F20D10.110; GH2; GSVIVT00002954001; GSVIVT000087190 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor | GO:0016616 | Molecular Function | 0.0 | - |
| Sma3 | cinnamyl-alcohol dehydrogenase activity | GO:0045551 | Molecular Function | 0.0 | - |
| Sma3 | mannitol dehydrogenase activity | GO:0046029 | Molecular Function | 0.0 | - |
| Sma3 | cofactor binding | GO:0048037 | Molecular Function | 0.0 | - |
| Sma3 | response to bacterium | GO:0009617 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Alcohol dehydrogenase superfamily, zinc-type | IPR002085 | - | 0.0 | - |
| Sma3 | Alcohol dehydrogenase, zinc-type, conserved site | IPR002328 | - | 0.0 | - |
| Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
| Sma3 | D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding | IPR006140 | - | 0.0 | - |
| Sma3 | Alcohol dehydrogenase, C-terminal | IPR013149 | - | 0.0 | - |
| Sma3 | Alcohol dehydrogenase GroES-like | IPR013154 | - | 0.0 | - |
| Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
| Sma3 | 4Fe-4S ferredoxin, iron-sulphur binding, conserved site | IPR017900 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G37990.1 | ELI3-2, ELI3, ATCAD8, CAD-B2 elicitor-activated gene 3-2 chr4:17855964-17857388 FORWARD LENGTH=359 | 3.0e-11 | 65% |
| RefSeq | Arabidopsis thaliana | NP_195512.1 | cinnamyl alcohol dehydrogenase 8 [Arabidopsis thaliana] | 4.0e-11 | 65% |
| RefSeq | Populus trichocarpa | XP_002309270.1 | cinnamyl alcohol dehydrogenase-like protein [Populus trichocarpa] | 6.0e-13 | 63% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NZE7
Fln msg: Distance to subject end: 190 aas, your sequence is shorter than subject: 58 - 364
Fln protein:
Y
Protein Length:
59
Fln nts:
G
Fln Alignment:
AllPine_a_c53573___YCEKVIWTYGSTDVDGSVTFGGYSSLMVCKQSFVVKIPESXXXXXXXXXXXXGITVYS
A9NZE7________________YCEKVVWTYNGIYVDGSPTLGGYSSLMVCDHRFVVKIPECLPFDAAAPLLCAGITVYS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
