UniGene Name: sp_v3.0_unigene118324
Length: 212 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene118324
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | GlimmerM protein 276 n=1 Tax=Beta vulgaris RepID=Q20CC6_BETVU | - | - | 3.0e-24 | 77% |
FL-Next | sp=Serine/threonine-protein kinase ATR; Oryza sativa subsp. japonica (Rice). | - | - | 0.0 | 75% |
Sma3 | Serine/threonine-protein kinase ATR | - | - | 1.251e-08 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Non-specific serine/threonine protein kinase. | EC:2.7.11.1 | - | 1.598e-06 | - |
Source | Gene names |
---|---|
Sma3 | ATR; At5g40820; GSVIVT00036181001; LOC_Os06g50910; MHK7.5; Os06g0724700; OsI_023634; OsI_24505; OsJ_22700; P0535F09.39; P0548E04.6; PHYPADRAFT_129584; POPTRDRAFT_790118; POPTRDRAFT_818220; RAD3; RCOM_0975960; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | chromosome | GO:0005694 | Cellular Component | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | DNA repair | GO:0006281 | Biological Process | 0.0 | - |
Sma3 | telomere maintenance via telomerase | GO:0007004 | Biological Process | 0.0 | - |
Sma3 | cell cycle | GO:0007049 | Biological Process | 0.0 | - |
Sma3 | meiosis | GO:0007126 | Biological Process | 0.0 | - |
Sma3 | response to aluminum ion | GO:0010044 | Biological Process | 0.0 | - |
Sma3 | response to gamma radiation | GO:0010332 | Biological Process | 0.0 | - |
Sma3 | regulation of telomere maintenance | GO:0032204 | Biological Process | 0.0 | - |
Sma3 | multicellular organism reproduction | GO:0032504 | Biological Process | 0.0 | - |
Sma3 | telomere maintenance in response to DNA damage | GO:0043247 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phosphatidylinositol 3-/4-kinase, catalytic domain | IPR000403 | - | 0.0 | - |
Sma3 | PIK-related kinase, FAT | IPR003151 | - | 0.0 | - |
Sma3 | PIK-related kinase, FATC | IPR003152 | - | 0.0 | - |
Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
Sma3 | UME | IPR012993 | - | 0.0 | - |
Sma3 | PIK-related kinase | IPR014009 | - | 0.0 | - |
Sma3 | Phosphatidylinositol 3/4-kinase, conserved site | IPR018936 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G40820.1 | ATRAD3, ATR, ATATR Ataxia telangiectasia-mutated and RAD3-related chr5:16343860-16353847 REVERSE LENGTH=2702 | 2.0e-23 | 67% |
RefSeq | Arabidopsis thaliana | NP_198898.2 | serine/threonine-protein kinase ATR [Arabidopsis thaliana] | 3.0e-23 | 67% |
RefSeq | Populus trichocarpa | XP_002334053.1 | predicted protein [Populus trichocarpa] | 1.0e-28 | 75% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q5Z987
Fln msg: Distance to subject end: 974 aas, your sequence is shorter than subject: 70 - 2710
Fln protein:
T
Protein Length:
71
Fln nts:
G
Fln Alignment:
AllPine_a_c53542___THVRGKSGSFNPAAGVSGAFADEDVSFLMEIYSGLDEPDGLFGLARLRRSANLQDQILINEKAGNWAEAL
Q5Z987________________SHVREKSGSSNPAADCSGAFSDDDISFLMEIYGGLDEPDGLLGLANLRKSSTLQDQLIINEKAGNWAEVL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain