UniGene Name: sp_v3.0_unigene117921
Length: 159 nt
UniGene Fasta |
---|
>sp_v3.0_unigene117921
C |
Ace file of the UniGene sp_v3.0_unigene117921 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Multicopper oxidase, type 1 n=1 Tax=Medicago truncatula RepID=A2Q4H7_MEDTR | - | - | 3.0e-09 | 64% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 84% |
Sma3 | Multicopper oxidase, putative | - | - | 2.986e-39 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | L-ascorbate oxidase. | EC:1.10.3.3 | - | 4.544e-29 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ascorbate and aldarate metabolism | 00053 | 4.544e-29 | % | |
Sma3 | Metabolic pathways | 01100 | 4.544e-29 | % |
Source | Gene names |
---|---|
Sma3 | AT1G76160; AT4g22010; AT4g37160; At1g21850; At1g21860; At1g41830; At1g55560; At1g55560/T5A14_2; At1g76160; At2g23630; At3g13400; At4g12420; At4g22010; At4g37160; At5g66920; C7A10.200; F5A13.5; GSVIVT00007292001; GSVIVT00010974001; GSVIVT00015539001; GSVIV |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | anchored to plasma membrane | GO:0046658 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | copper ion binding | GO:0005507 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | pectinesterase activity | GO:0030599 | Molecular Function | 0.0 | - |
Sma3 | cell tip growth | GO:0009932 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Multicopper oxidase, type 1 | IPR001117 | - | 0.0 | - |
Sma3 | Lipocalin | IPR002345 | - | 0.0 | - |
Sma3 | Cupredoxin | IPR008972 | - | 0.0 | - |
Sma3 | Multicopper oxidase, type 2 | IPR011706 | - | 0.0 | - |
Sma3 | Multicopper oxidase, type 3 | IPR011707 | - | 0.0 | - |
Sma3 | Beta tubulin, autoregulation binding site | IPR013838 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G66920.1 | sks17 SKU5 similar 17 chr5:26722963-26725370 FORWARD LENGTH=546 | 3.0e-11 | 64% |
RefSeq | Arabidopsis thaliana | NP_569041.1 | protein SKU5 similar 17 [Arabidopsis thaliana] | 3.0e-11 | 64% |
RefSeq | Populus trichocarpa | XP_002301616.1 | predicted protein [Populus trichocarpa] | 2.0e-13 | 75% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LRP4
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 444 aas, your sequence is shorter than subject: 52 - 542
Fln protein:
S
Protein Length:
53
Fln nts:
C
Fln Alignment:
AllPine_a_c53029___KFPGPQIDSVTXXXXXXXXXXKLDQAFLISWSGIQQRRNSWQDGV
B8LRP4________________QFPGPRIDSVTNDNIIVNVFNSLDQPFLISWSGIQQRRNSWQDGV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain