|
||||||
|
UniGene Name: sp_v3.0_unigene117705
Length: 240 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene117705
C |
|
Ace file of the UniGene sp_v3.0_unigene117705
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Glucose-6-phosphate/phosphate translocator 2 n=2 Tax=Andropogoneae RepID=B6SRN7_MAIZE | - | - | 2.0e-33 | 87% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 81% |
| Sma3 | Glucose-6-phosphate/phosphate translocator | - | - | 1.798e-11 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g61800; At5g17630; At5g54800; B1099H05.2; F8K4.1; GPT; GPT1; GPT2; GSVIVT00006900001; GSVIVT00022919001; GSVIVT00027370001; K10A8_110; MBG8.6; NtGPT; OJ1372_D12.143-1; OJ1372_D12.152; OSJNBb0052O11.102; OSTLU_14537; Os07g0523400; Os07g0523600; Os08g018 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | plastid | GO:0009536 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | enzyme inhibitor activity | GO:0004857 | Molecular Function | 0.0 | - |
| Sma3 | transporter activity | GO:0005215 | Molecular Function | 0.0 | - |
| Sma3 | pectinesterase activity | GO:0030599 | Molecular Function | 0.0 | - |
| Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
| Sma3 | response to nematode | GO:0009624 | Biological Process | 0.0 | - |
| Sma3 | response to sucrose stimulus | GO:0009744 | Biological Process | 0.0 | - |
| Sma3 | response to glucose stimulus | GO:0009749 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Drug/metabolite transporter | IPR000620 | - | 0.0 | - |
| Sma3 | Tpt phosphate/phosphoenolpyruvate translocator | IPR004696 | - | 0.0 | - |
| Sma3 | Domain of unknown function DUF250 | IPR004853 | - | 0.0 | - |
| Sma3 | Pectinesterase inhibitor | IPR006501 | - | 0.0 | - |
| Sma3 | HTH domain AraC-type, conserved site | IPR018062 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G61800.1 | GPT2, ATGPT2 glucose-6-phosphate/phosphate translocator 2 chr1:22824527-22826459 FORWARD LENGTH=388 | 6.0e-40 | 79% |
| RefSeq | Arabidopsis thaliana | NP_564785.1 | glucose-6-phosphate/phosphate translocator 2 [Arabidopsis thaliana] | 7.0e-40 | 79% |
| RefSeq | Populus trichocarpa | XP_002316985.1 | predicted protein [Populus trichocarpa] | 3.0e-39 | 78% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PQD0
Fln msg: Distance to subject end: 142 aas, your sequence is shorter than subject: 80 - 341
Fln protein:
H
Protein Length:
81
Fln nts:
C
Fln Alignment:
AllPine_a_c52777___HKKVLNVFPYPWLTSTLSLAAGSAIMLATWATRVVEAPETDLQFWKALIPVAIAHTIGHVAATVSMSKVAVSFTHVIKSA
C0PQD0________________NKKVLNAFPYPWLTSTLSLAVGSLMMWVSWATRLVDAPDTDLEFWKALAPVAVAHTIGHVAATVSMSKVAVSFTHIIKSA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
