|
||||||
|
UniGene Name: sp_v3.0_unigene117329
Length: 161 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene117329
C |
|
Ace file of the UniGene sp_v3.0_unigene117329
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Cytochrome P450 n=3 Tax=Oryza sativa RepID=Q5CCK3_ORYSJ | - | - | 2.0e-07 | 76% |
| FL-Next | tr=CYP720B2; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 68% |
| Source | Gene names |
|---|---|
| Sma3 | At3g50660; CYP90B1; CYP90B7v1; DWF4; LOC_Os03g12660; OJ1626B05.9; Os03g0227700; OsDWARF4; OsI_10612; OsJ_10004; POPTRDRAFT_719487; POPTRDRAFT_796803; T3A5.40; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | steroid 22-alpha hydroxylase activity | GO:0010012 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | response to brassinosteroid stimulus | GO:0009741 | Biological Process | 0.0 | - |
| Sma3 | unidimensional cell growth | GO:0009826 | Biological Process | 0.0 | - |
| Sma3 | leaf shaping | GO:0010358 | Biological Process | 0.0 | - |
| Sma3 | brassinosteroid biosynthetic process | GO:0016132 | Biological Process | 0.0 | - |
| Sma3 | leaf development | GO:0048366 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cytochrome P450 | IPR001128 | - | 0.0 | - |
| Sma3 | Cytochrome P450, E-class, group I | IPR002401 | - | 0.0 | - |
| Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
| Sma3 | IPR017973 | - | 0.0 | - | |
| Sma3 | Peptidase S26A, signal peptidase I, conserved site | IPR019758 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G50660.1 | DWF4, CYP90B1, CLM, SNP2, SAV1, PSC1 Cytochrome P450 superfamily protein chr3:18814262-18817168 REVERSE LENGTH=513 | 2.0e-11 | 76% |
| RefSeq | Arabidopsis thaliana | NP_190635.1 | cytochrome P450 90B1 [Arabidopsis thaliana] | 3.0e-11 | 76% |
| RefSeq | Populus trichocarpa | XP_002323666.1 | cytochrome P450 probable campestanol to 6-deoxocathasterone or 6-oxocampestanol to cathasterone [Populus trichocarpa] | 4.0e-11 | 71% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: E5FA69
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 17 aas, your sequence is shorter than subject: 49 - 486
Fln protein:
R
Protein Length:
50
Fln nts:
C
Fln Alignment:
AllPine_a_c52351___FGGGLRYCLGSELAKLEMGVFLHHLVTKFRWE
E5FA69________________FGGGARLCPGMHLAKLELALFLHNFVTKFRWE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
