UniGene Name: sp_v3.0_unigene116735
Length: 234 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene116735
C |
Ace file of the UniGene sp_v3.0_unigene116735
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Laccase n=2 Tax=Pinus taeda RepID=Q9AUI3_PINTA | - | - | 2.0e-27 | 71% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 72% |
| Sma3 | Laccase, putative | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Laccase. | EC:1.10.3.2 | - | 0.0 | - |
| Sma3 | L-ascorbate oxidase. | EC:1.10.3.3 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ascorbate and aldarate metabolism | 00053 | 0.0 | % | |
| Sma3 | Metabolic pathways | 01100 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g18140; At2g29130; At2g30210; At2g38080; At2g40370; At3g09220; At5g01040; At5g01050; At5g01190; At5g05390; At5g07130; At5g09360; At5g58910; At5g60020; B1045D11.30; B1088C09.5; F16M14.1; F3L24.9; F7J8.170; F7J8.20; F7J8.30; GLac3; GLac90; GSVIVT00001780 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | copper ion binding | GO:0005507 | Molecular Function | 0.0 | - |
| Sma3 | laccase activity | GO:0008471 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | response to water deprivation | GO:0009414 | Biological Process | 0.0 | - |
| Sma3 | secondary cell wall biogenesis | GO:0009834 | Biological Process | 0.0 | - |
| Sma3 | vegetative to reproductive phase transition of meristem | GO:0010228 | Biological Process | 0.0 | - |
| Sma3 | lignin catabolic process | GO:0046274 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidase, cysteine peptidase active site | IPR000169 | - | 0.0 | - |
| Sma3 | Regulator of chromosome condensation, RCC1 | IPR000408 | - | 0.0 | - |
| Sma3 | Oxidoreductase, molybdopterin-binding domain | IPR000572 | - | 0.0 | - |
| Sma3 | Multicopper oxidase, type 1 | IPR001117 | - | 0.0 | - |
| Sma3 | Multicopper oxidase, copper-binding site | IPR002355 | - | 0.0 | - |
| Sma3 | Auxin efflux carrier | IPR004776 | - | 0.0 | - |
| Sma3 | Bacterial extracellular solute-binding family 1, conserved site | IPR006061 | - | 0.0 | - |
| Sma3 | Cupredoxin | IPR008972 | - | 0.0 | - |
| Sma3 | TonB box, conserved site | IPR010916 | - | 0.0 | - |
| Sma3 | Multicopper oxidase, type 2 | IPR011706 | - | 0.0 | - |
| Sma3 | Multicopper oxidase, type 3 | IPR011707 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat 3 | IPR011713 | - | 0.0 | - |
| Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
| Sma3 | Laccase | IPR017761 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, family 1, active site | IPR018120 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G05390.1 | LAC12 laccase 12 chr5:1594753-1597042 FORWARD LENGTH=565 | 3.0e-30 | 68% |
| RefSeq | Arabidopsis thaliana | NP_196158.1 | laccase 12 [Arabidopsis thaliana] | 3.0e-30 | 68% |
| RefSeq | Populus trichocarpa | XP_002312186.1 | laccase 90a [Populus trichocarpa] | 3.0e-31 | 67% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LPF9
Fln msg: Distance to subject end: 463 aas, your sequence is shorter than subject: 78 - 573
Fln protein:
R
Protein Length:
79
Fln nts:
C
Fln Alignment:
AllPine_a_c51670___ITGLCKTYGLVVVNGQLPGPTIHVRNGDSLIVKVYNRGKYNATIHWHGVRQLRTGWADGPGYITQCPIQP
B8LPF9________________VTRLCKTHNVIIVNGQFPGPTLHVRNGDTLSVKVYNRAQYNATVHWHGIRQFRTGWADGPEFITQCPIRP

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta