UniGene Name: sp_v3.0_unigene116367
Length: 210 nt
UniGene Fasta |
---|
>sp_v3.0_unigene116367
C |
Ace file of the UniGene sp_v3.0_unigene116367 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Unassigned protein | - | - | 0.0 | - |
FL-Next | sp=Receptor-like protein kinase ANXUR1; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 71% |
Sma3 | Receptor-protein kinase-like protein | - | - | 1.027e-10 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Non-specific protein-tyrosine kinase. | EC:2.7.10.2 | - | 1.654e-10 | - |
Source | Gene names |
---|---|
Sma3 | AT4g39110; At2g21480; At3g04690; At3g46290; At3g51550; At4g39110; At5g24010; At5g28680; At5g54380; At5g59700; At5g61350; B1143G03.32; F12M12.260; F18L15.10; F19H22.210; F26O13.190; F7O18.16; FER; GSVIVT00016292001; GSVIVT00019574001; GSVIVT00019575001; GS |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | kinase activity | GO:0016301 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | protein autophosphorylation | GO:0046777 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
Sma3 | Zinc finger, RING-type | IPR001841 | - | 0.0 | - |
Sma3 | Peptidase aspartic, active site | IPR001969 | - | 0.0 | - |
Sma3 | Isopenicillin N synthase, conserved site | IPR002057 | - | 0.0 | - |
Sma3 | Immunoglobulin/major histocompatibility complex, conserved site | IPR003006 | - | 0.0 | - |
Sma3 | Peptidase S16, lon N-terminal | IPR003111 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
Sma3 | SKG6/AXL2 alpha-helix transmembrane domain | IPR014805 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | Zinc finger, RING-type, conserved site | IPR017907 | - | 0.0 | - |
Sma3 | Zinc finger, C3HC4 RING-type | IPR018957 | - | 0.0 | - |
Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G04690.1 | ANX1 Malectin/receptor-like protein kinase family protein chr3:1273386-1275938 REVERSE LENGTH=850 | 8.0e-13 | 71% |
RefSeq | Arabidopsis thaliana | NP_187120.1 | receptor-like protein kinase ANXUR1 [Arabidopsis thaliana] | 1.0e-12 | 71% |
RefSeq | Populus trichocarpa | XP_002328487.1 | predicted protein [Populus trichocarpa] | 1.0e-14 | 78% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9SR05
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 99 aas, your sequence is shorter than subject: 69 - 850
Fln protein:
S
Protein Length:
70
Fln nts:
C
Fln Alignment:
AllPine_a_c51230___ARPALNPTLPREQVSLAEWALHCLKKGTLEHIIDPHLK
Q9SR05________________ARPALNPSLPKEQVSLGDWAMNCKRKGNLEDIIDPNLK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain