|
||||||
|
UniGene Name: sp_v3.0_unigene116176
Length: 200 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene116176
C |
|
Ace file of the UniGene sp_v3.0_unigene116176
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Phosphatidylinositol phoshate kinase n=2 Tax=Physcomitrella patens RepID=B5TVL8_9BRYO | - | - | 3.0e-25 | 85% |
| FL-Next | sp=Phosphatidylinositol 4-phosphate 5-kinase 9; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 85% |
| Sma3 | Phosphatidylinositol-4-phosphate 5-kinase, putative | - | - | 1.117e-19 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | 1-phosphatidylinositol-4-phosphate 5-kinase. | EC:2.7.1.68 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Inositol phosphate metabolism | 00562 | 0.0 | % | |
| Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
| Sma3 | Phosphatidylinositol signaling system | 04070 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g10900; At1g21980; At1g60890; At1g77740; At2g26420; At2g41210; At3g07960; At3g09920; At3g56960; F17A17.30; F24I3.40; F2E2.1; F8A24.2; GSVIVT00000598001; GSVIVT00000653001; GSVIVT00015324001; GSVIVT00017467001; GSVIVT00026524001; GSVIVT00030918001; LOC_ |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | apical plasma membrane | GO:0016324 | Cellular Component | 0.0 | - |
| Sma3 | cytosolic part | GO:0044445 | Cellular Component | 0.0 | - |
| Sma3 | actin monomer binding | GO:0003785 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | phosphatidylinositol phosphate kinase activity | GO:0016307 | Molecular Function | 0.0 | - |
| Sma3 | 1-phosphatidylinositol-4-phosphate 5-kinase activity | GO:0016308 | Molecular Function | 0.0 | - |
| Sma3 | actin filament binding | GO:0051015 | Molecular Function | 0.0 | - |
| Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
| Sma3 | cellular amino acid metabolic process | GO:0006520 | Biological Process | 0.0 | - |
| Sma3 | endocytosis | GO:0006897 | Biological Process | 0.0 | - |
| Sma3 | response to stress | GO:0006950 | Biological Process | 0.0 | - |
| Sma3 | establishment of tissue polarity | GO:0007164 | Biological Process | 0.0 | - |
| Sma3 | plant-type cell wall modification | GO:0009827 | Biological Process | 0.0 | - |
| Sma3 | pollen germination | GO:0009846 | Biological Process | 0.0 | - |
| Sma3 | pollen tube growth | GO:0009860 | Biological Process | 0.0 | - |
| Sma3 | flower development | GO:0009908 | Biological Process | 0.0 | - |
| Sma3 | stomatal movement | GO:0010118 | Biological Process | 0.0 | - |
| Sma3 | cell differentiation | GO:0030154 | Biological Process | 0.0 | - |
| Sma3 | phosphatidylinositol metabolic process | GO:0046488 | Biological Process | 0.0 | - |
| Sma3 | root hair cell tip growth | GO:0048768 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidase, cysteine peptidase active site | IPR000169 | - | 0.0 | - |
| Sma3 | Short-chain dehydrogenase/reductase SDR | IPR002198 | - | 0.0 | - |
| Sma3 | Phosphatidylinositol-4-phosphate 5-kinase, core | IPR002498 | - | 0.0 | - |
| Sma3 | MORN motif | IPR003409 | - | 0.0 | - |
| Sma3 | Phosphatidylinositol-4-phosphate 5-kinase, core, subgroup | IPR016034 | - | 0.0 | - |
| Sma3 | Phosphatidylinositol-4-phosphate 5-kinase, plant | IPR017163 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G09920.1 | PIP5K9 phosphatidyl inositol monophosphate 5 kinase chr3:3040426-3043676 REVERSE LENGTH=815 | 3.0e-31 | 85% |
| RefSeq | Arabidopsis thaliana | NP_001189852.1 | phosphatidylinositol-4-phosphate 5-kinase 9 [Arabidopsis thaliana] | 3.0e-31 | 85% |
| RefSeq | Populus trichocarpa | XP_002326384.1 | predicted protein, partial [Populus trichocarpa] | 8.0e-31 | 83% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q8L850
Fln msg: Distance to subject end: 299 aas, your sequence is shorter than subject: 66 - 815
Fln protein:
S
Protein Length:
67
Fln nts:
C
Fln Alignment:
AllPine_a_c50993___DYCPMVFRHLRELFKIDAAEYMLSICGNDALRELSSPGKSGSVFYLSHDDKFMIKTMRKSEV
Q8L850________________DYCPMVFRNLREMFKIDAADYMMSICGNDTLRELSSPGKSGSVFFLSQDDRFMIKTLRKSEV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
