UniGene Name: sp_v3.0_unigene116157
Length: 180 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene116157
G |
Ace file of the UniGene sp_v3.0_unigene116157
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | cytokinin oxidase/dehydrogenase 6 [Arabidopsis thaliana] sp|Q9LY71.2|CKX6_ARATH RecName: Full=Cytokinin dehydrogenase 6; AltName: Full=Cytokinin oxidase 6; Short=AtCKX6; Short=AtCKX7; Short=CKO6; Flags: Precursor gb|AEE80482.1| cytokinin oxidase/dehydroge | - | - | 6.0e-14 | 76% |
| FL-Next | sp=Cytokinin dehydrogenase 6; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 76% |
| Sma3 | Cytokinin oxidase | - | - | 2.64e-39 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cytokinin dehydrogenase. | EC:1.5.99.12 | - | 1.4013e-45 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Zeatin biosynthesis | 00908 | 1.4013e-45 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g75450; At2g19500; At2g41510; At3g63440; At5g56970; B1131G07.3; B1131G07.5; B1150F11.25; BoCKX1; BrCKX1; CKX; CKX1; CKX10; CKX2; CKX3; CKX5; CKX6; CKX7; F1B16.2; F3P11.10; GSVIVT00013006001; GSVIVT00014541001; GSVIVT00016550001; GSVIVT00025661001; GSVI |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
| Sma3 | endoplasmic reticulum lumen | GO:0005788 | Cellular Component | 0.0 | - |
| Sma3 | primary amine oxidase activity | GO:0008131 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | cytokinin dehydrogenase activity | GO:0019139 | Molecular Function | 0.0 | - |
| Sma3 | flavin adenine dinucleotide binding | GO:0050660 | Molecular Function | 0.0 | - |
| Sma3 | cytokinin metabolic process | GO:0009690 | Biological Process | 0.0 | - |
| Sma3 | cytokinin catabolic process | GO:0009823 | Biological Process | 0.0 | - |
| Sma3 | meristem development | GO:0048507 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Oxygen oxidoreductase covalent FAD-binding site | IPR006093 | - | 0.0 | - |
| Sma3 | FAD linked oxidase, N-terminal | IPR006094 | - | 0.0 | - |
| Sma3 | Cytokinin dehydrogenase 1, FAD/cytokinin binding domain | IPR015345 | - | 0.0 | - |
| Sma3 | FAD-binding, type 2 | IPR016166 | - | 0.0 | - |
| Sma3 | FAD-binding, type 2, subdomain 1 | IPR016167 | - | 0.0 | - |
| Sma3 | FAD-linked oxidase, FAD-binding, subdomain 2 | IPR016168 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G63440.1 | ATCKX6, CKX6, ATCKX7 cytokinin oxidase/dehydrogenase 6 chr3:23424291-23426265 FORWARD LENGTH=533 | 2.0e-18 | 76% |
| RefSeq | Arabidopsis thaliana | NP_191903.3 | cytokinin oxidase/dehydrogenase 6 [Arabidopsis thaliana] | 3.0e-18 | 76% |
| RefSeq | Populus trichocarpa | XP_002304773.1 | cytokinin oxidase [Populus trichocarpa] | 1.0e-18 | 76% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9LY71
Fln msg: Distance to subject end: 262 aas, your sequence is shorter than subject: 60 - 533
Fln protein:
E
Protein Length:
61
Fln nts:
G
Fln Alignment:
AllPine_a_c50974___EILNCSRHQNGDLFQAVLGGLGQFGIITKARIELEPAPQRVRWIRVL
Q9LY71________________EILNCTKRQNSDLFNGVLGGLGQFGIITRARIALEPAPTMVKWIRVL

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta