SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene115931

Length: 452 nt

UniGene Fasta

>sp_v3.0_unigene115931
ATACATGGGAATGGACGTCTATCGCTTTTCTATTTCCTGGCCACGCATATTTCCCAAGGGCTCTCCCAGACACGGAGGAGTCAATGAAGAGGGAATTTCGTATTACAATAATCTCATCAACGAGCTGCTCAAAAATGGTATACAGCCTTTTGTTACACTATTTCACTGGGACTTGCCACAAGCTCTGGAGGATGAGTATGGGGGATTCCGTAGCAAAAGAGTAGTGGCGGACTTTAGCTTATTCGCAGATCAATGTTTTCGATCTTTTGGAGACCGTGTGAAGTATTGGCTAACTATAAACGAACCATTTGTCTTCTCGGTATATGGCTACGATTTAGGGCTTCTCGCACCCGGCCGTTGTTCAGCTCCATTTGGAAACTGTACATCAGGAAATTCTGCAACGGAGCCCTACATTGTAGCGCATAATTTGCTTCTTGCACATAGCGCTGCCG

Ace file of the UniGene sp_v3.0_unigene115931

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	Identity
AutoFact	beta-primeverosidase [Camellia sinensis]	-	-	64%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	81%
Sma3	Beta-glucosidase, putative	-	-	-

Source	ECs	Term	Type	e value	Identity
Sma3	Prunasin beta-glucosidase.	EC:3.2.1.118	-	9.676e-11	-

Source	KEGGs	Term	Type	e value	Identity
Sma3	Cyanoamino acid metabolism	00460		9.676e-11	%
Sma3	Beta-glucosidase.	EC:3.2.1.21	-	0.0	-

Source	KEGGs	Term	Type	e value	Identity
Sma3	Cyanoamino acid metabolism	00460		0.0	%
Sma3	Starch and sucrose metabolism	00500		0.0	%
Sma3	Phenylpropanoid biosynthesis	00940		0.0	%
Sma3	Biosynthesis of secondary metabolites	01110		0.0	%
Sma3	Beta-D-fucosidase.	EC:3.2.1.38	-	5.433e-07	-

Source	Gene names
Sma3	AH1; AT3G09260; AT3G18080; AT4g22100; AT4g27820; AT4g27830; At1g02850; At1g02850/F22D16.15; At1g26560; At2g25630; At2g32860; At2g44450; At2g44460; At2g44470; At2g44480; At3g03640; At3g18080; At3g60120; At3g60130; At3g60140; At4g22100; At4g27830; At5g24540

Source	GOs	Term	Type	Identity
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	vacuole	GO:0005773	Cellular Component	-
Sma3	peroxisome	GO:0005777	Cellular Component	-
Sma3	plant-type cell wall	GO:0009505	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	ER body	GO:0010168	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	cytosolic ribosome	GO:0022626	Cellular Component	-
Sma3	apoplast	GO:0048046	Cellular Component	-
Sma3	hydrolase activity, hydrolyzing O-glycosyl compounds	GO:0004553	Molecular Function	-
Sma3	copper ion binding	GO:0005507	Molecular Function	-
Sma3	beta-glucosidase activity	GO:0008422	Molecular Function	-
Sma3	fucosidase activity	GO:0015928	Molecular Function	-
Sma3	thioglucosidase activity	GO:0019137	Molecular Function	-
Sma3	beta-D-fucosidase activity	GO:0033907	Molecular Function	-
Sma3	cation binding	GO:0043169	Molecular Function	-
Sma3	amygdalin beta-glucosidase activity	GO:0047668	Molecular Function	-
Sma3	prunasin beta-glucosidase activity	GO:0050224	Molecular Function	-
Sma3	raucaffricine beta-glucosidase activity	GO:0050247	Molecular Function	-
Sma3	beta-primeverosidase activity	GO:0050535	Molecular Function	-
Sma3	carbohydrate metabolic process	GO:0005975	Biological Process	-
Sma3	response to symbiotic fungus	GO:0009610	Biological Process	-
Sma3	response to salt stress	GO:0009651	Biological Process	-
Sma3	cytokinin mediated signaling pathway	GO:0009736	Biological Process	-
Sma3	response to other organism	GO:0051707	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Glycoside hydrolase, family 1	IPR001360	-	-
Sma3	Glycoside hydrolase, subgroup, catalytic domain	IPR013781	-	-
Sma3	DNA methylase, C-5 cytosine-specific, active site	IPR018117	-	-
Sma3	Glycoside hydrolase, family 1, active site	IPR018120	-	-

Source	Species	ID	Description	Identity
ATG	Arabidoptis thaliana	AT2G44480.1	BGLU17 beta glucosidase 17 chr2:18359780-18363001 FORWARD LENGTH=517	63%
RefSeq	Arabidopsis thaliana	NP_001118525.1	beta glucosidase 17 [Arabidopsis thaliana]	63%
RefSeq	Populus trichocarpa	XP_002305150.1	predicted protein [Populus trichocarpa]	67%

Full-Lengther Next Prediction

Fln status: N-terminus

Fln database: coniferopsida.fasta

Fln subject: B8LQ52

Fln msg: Distance to subject end: 258 aas, your sequence is shorter than subject: 149 - 407

Fln protein: MGMDVYRFSISWPRIFPKGSPRHGGVNEEGISYYNNLINELLKNGIQPFVTLFHWDLPQALEDEYGGFRSKRVVADFSLFADQCFRSFGDRVKYWLTINEPFVFSVYGYDLGLLAPGRCSAPFGNCTSGNSATEPYIVAHNLLLAHSAA

Protein Length: 150

Fln nts: ATAC_-_ATGGGAATGGACGTCTATCGCTTTTCTATTTCCTGGCCACGCATATTTCCCAAGGGCTCTCCCAGACACGGAGGAGTCAATGAAGAGGGAATTTCGTATTACAATAATCTCATCAACGAGCTGCTCAAAAATGGTATACAGCCTTTTGTTACACTATTTCACTGGGACTTGCCACAAGCTCTGGAGGATGAGTATGGGGGATTCCGTAGCAAAAGAGTAGTGGCGGACTTTAGCTTATTCGCAGATCAATGTTTTCGATCTTTTGGAGACCGTGTGAAGTATTGGCTAACTATAAACGAACCATTTGTCTTCTCGGTATATGGCTACGATTTAGGGCTTCTCGCACCCGGCCGTTGTTCAGCTCCATTTGGAAACTGTACATCAGGAAATTCTGCAACGGAGCCCTACATTGTAGCGCATAATTTGCTTCTTGCACATAGCGCTGCCG

Fln Alignment:

AllPine_a_c50682___MGMDVYRFSISWPRIFPKGSPRHGGVNEEGISYYNNLINELLKNGIQPFVTLFHWDLPQALEDEYGGFRSKRVVADFSLFADQCFRSFGDRVKYWLTINEPFVFSVYGYDLGLLAPGRCSAPFGNCTSGNSATEPYIVAHNLLLAHSAA
B8LQ52________________MGMDVYRFSISWSRIFPKGSPRHGRVNEEGIIYYNNLINELLKNGIEPFITLFHWDMPQALEDEYGGFRSKRIVEDFGIFAEECFRAFGDRVKYWVTVNEPLVFSLGGYDLGIHAPGRCSAGFGNCTAGNSAKEPYMVTHNMLLAHAAA

SNPs (tot: 2)

Position	A %	C %	G %	T %	Probability
224		33	66		0.997452
241	66	33			0.997452

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain