UniGene Name: sp_v3.0_unigene115897
Length: 243 nt
![]() |
---|
>sp_v3.0_unigene115897
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Unassigned protein | - | - | 0.0 | - |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 95% |
Sma3 | Tetratricopeptide-like helical | - | - | 2.048e-09 | - |
Source | Gene names |
---|---|
Sma3 | At1g08070; At1g09190; At1g09410; At1g20230; At1g74630; At2g13600; At2g22070; At2g29760; At3g13770; At3g14330; At3g22690; At3g24000; At3g46790; At4g02750; At4g16835; At4g33990; At5g04780; At5g08510; At5g15300; At5g39350; At5g44230; B1032F05.19; B1080A02.28 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | deaminase activity | GO:0019239 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | purine ribonucleoside monophosphate biosynthetic process | GO:0009168 | Biological Process | 0.0 | - |
Sma3 | RNA modification | GO:0009451 | Biological Process | 0.0 | - |
Sma3 | thylakoid membrane organization | GO:0010027 | Biological Process | 0.0 | - |
Sma3 | photosystem II assembly | GO:0010207 | Biological Process | 0.0 | - |
Sma3 | regulation of chlorophyll biosynthetic process | GO:0010380 | Biological Process | 0.0 | - |
Sma3 | chloroplast RNA processing | GO:0031425 | Biological Process | 0.0 | - |
Sma3 | polycistronic mRNA processing | GO:0031426 | Biological Process | 0.0 | - |
Sma3 | cell redox homeostasis | GO:0045454 | Biological Process | 0.0 | - |
Sma3 | photosystem I assembly | GO:0048564 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Armadillo | IPR000225 | - | 0.0 | - |
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Beta-lactamase, class-A/D | IPR000871 | - | 0.0 | - |
Sma3 | Mannose-binding lectin | IPR001229 | - | 0.0 | - |
Sma3 | Adenosine/AMP deaminase domain | IPR001365 | - | 0.0 | - |
Sma3 | Kinesin, motor domain | IPR001752 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Armadillo-like helical | IPR011989 | - | 0.0 | - |
Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
Sma3 | IPR012335 | - | 0.0 | - | |
Sma3 | Thioredoxin domain | IPR013766 | - | 0.0 | - |
Sma3 | Aldehyde dehydrogenase, conserved site | IPR016160 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G09410.1 | pentatricopeptide (PPR) repeat-containing protein chr1:3035443-3037560 FORWARD LENGTH=705 | 2.0e-27 | 56% |
RefSeq | Arabidopsis thaliana | NP_172412.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 2.0e-27 | 56% |
RefSeq | Populus trichocarpa | XP_002314110.1 | predicted protein [Populus trichocarpa] | 3.0e-29 | 61% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9P0W0
Fln msg: Distance to subject end: 143 aas, your sequence is shorter than subject: 81 - 370
Fln protein:
R
Protein Length:
82
Fln nts:
C
Fln Alignment:
AllPine_a_c50645___RAGCLDEALNFINQMPVEPNASVWGSLLGACRVHGNIELAERAVEQLIELTPENPGTYVLLSNIYAAAGKWDDVAKVRRMM
A9P0W0________________RAGCLDEALNFINQMPVEPNASVWGSLLGACRVHGNIELAERAVEQLIELTPENPGTYVLLSNIYAAAGRWDDAGKVRKMM
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain