UniGene Name: sp_v3.0_unigene115625
Length: 226 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene115625
C |
Ace file of the UniGene sp_v3.0_unigene115625
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Phosphoenolpyruvate carboxykinase [ATP], putative n=1 Tax=Ricinus communis RepID=B9R6Q4_RICCO | - | - | 9.0e-29 | 86% |
| FL-Next | sp=Phosphoenolpyruvate carboxykinase [ATP]; Cucumis sativus (Cucumber). | - | - | 0.0 | 85% |
| Sma3 | Phosphoenolpyruvate carboxykinase | - | - | 1.714e-12 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phosphoenolpyruvate carboxykinase (ATP). | EC:4.1.1.49 | - | 2.859e-27 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycolysis / Gluconeogenesis | 00010 | 2.859e-27 | % | |
| Sma3 | Citrate cycle (TCA cycle) | 00020 | 2.859e-27 | % | |
| Sma3 | Pyruvate metabolism | 00620 | 2.859e-27 | % | |
| Sma3 | Carbon fixation in photosynthetic organisms | 00710 | 2.859e-27 | % | |
| Sma3 | Metabolic pathways | 01100 | 2.859e-27 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 2.859e-27 | % |
| Source | Gene names |
|---|---|
| Sma3 | At4g37870; At5g65690; CHLREDRAFT_196612; F6H11.190; GSVIVT00011154001; LOC_Os03g15050; LOC_Os10g13700; OSJNBa0004P12.17; OSJNBb0048O22.3; Os03g0255500; Os10g0204400; OsI_10803; OsI_33003; OsJ_10175; OsJ_31009; PCK; PCK1; PCK1b|PCK1a; PCK2; PCKA; PHYPADRAF |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | phosphoenolpyruvate carboxykinase (ATP) activity | GO:0004612 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | kinase activity | GO:0016301 | Molecular Function | 0.0 | - |
| Sma3 | gluconeogenesis | GO:0006094 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phosphoenolpyruvate carboxykinase, ATP-utilising | IPR001272 | - | 0.0 | - |
| Sma3 | Phosphoenolpyruvate carboxykinase, N-terminal | IPR008210 | - | 0.0 | - |
| Sma3 | Phosphoenolpyruvate carboxykinase, C-terminal | IPR013035 | - | 0.0 | - |
| Sma3 | Aldehyde dehydrogenase domain | IPR015590 | - | 0.0 | - |
| Sma3 | Phosphoenolpyruvate carboxykinase (ATP), conserved site | IPR015994 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G37870.1 | PCK1, PEPCK phosphoenolpyruvate carboxykinase 1 chr4:17802974-17806332 REVERSE LENGTH=671 | 1.0e-35 | 87% |
| RefSeq | Arabidopsis thaliana | NP_195500.1 | phosphoenolpyruvate carboxykinase [ATP] [Arabidopsis thaliana] | 2.0e-35 | 87% |
| RefSeq | Populus trichocarpa | XP_002310867.1 | predicted protein [Populus trichocarpa] | 2.0e-35 | 86% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: P42066
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 174 aas, your sequence is shorter than subject: 74 - 670
Fln protein:
S
Protein Length:
75
Fln nts:
C
Fln Alignment:
AllPine_a_c50332___ILENVVFDEHTREVDYSDKSVTENTRASYPIEFIPNARIPCVGPHPKNIVLLAYDAFGVLPPVSRLT
P42066________________VLENVVFDEHTREVDYSEKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLS

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta