UniGene Name: sp_v3.0_unigene115335
Length: 224 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene115335
T |
Ace file of the UniGene sp_v3.0_unigene115335
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | ABC transporter G family member 35 [Arabidopsis thaliana] sp|Q7PC86.1|AB35G_ARATH RecName: Full=ABC transporter G family member 35; Short=ABC transporter ABCG.35; Short=AtABCG35; AltName: Full=Probable pleiotropic drug resistance protein 7 tpg|DAA00875.1| | - | - | 5.0e-28 | 82% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 69% |
| Sma3 | ATP-binding cassette transporter, putative | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phosphonate-transporting ATPase. | EC:3.6.3.28 | - | 0.0 | - |
| Sma3 | Heme-transporting ATPase. | EC:3.6.3.41 | - | 9.335e-11 | - |
| Source | Gene names |
|---|---|
| Sma3 | ABC1; At1g15210; At1g15520; At1g59870; At1g66950; At2g26910; At2g29940; At2g36380; At2g37280; At3g16340; At3g30842; At3g53480; At4g15215; At4g15220/At4g15230; At4g15233; At4g15236; B1045F02.15; B1090H08.39; F12C20.5; F1O11.1; F1O19.3; F23F1.14; F23H11.19; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | nucleotide binding | GO:0000166 | Molecular Function | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | cadmium ion transmembrane transporter activity | GO:0015086 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity | GO:0016887 | Molecular Function | 0.0 | - |
| Sma3 | nucleoside-triphosphatase activity | GO:0017111 | Molecular Function | 0.0 | - |
| Sma3 | protein dimerization activity | GO:0046983 | Molecular Function | 0.0 | - |
| Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
| Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
| Sma3 | response to biotic stimulus | GO:0009607 | Biological Process | 0.0 | - |
| Sma3 | systemic acquired resistance | GO:0009627 | Biological Process | 0.0 | - |
| Sma3 | response to ethylene stimulus | GO:0009723 | Biological Process | 0.0 | - |
| Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
| Sma3 | response to jasmonic acid stimulus | GO:0009753 | Biological Process | 0.0 | - |
| Sma3 | defense response to fungus, incompatible interaction | GO:0009817 | Biological Process | 0.0 | - |
| Sma3 | response to ozone | GO:0010193 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Sma3 | cadmium ion transport | GO:0015691 | Biological Process | 0.0 | - |
| Sma3 | lead ion transport | GO:0015692 | Biological Process | 0.0 | - |
| Sma3 | negative regulation of defense response | GO:0031348 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
| Sma3 | Ribosomal protein L11 | IPR000911 | - | 0.0 | - |
| Sma3 | Legume lectin domain | IPR001220 | - | 0.0 | - |
| Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
| Sma3 | Proteinase inhibitor I2, Kunitz metazoa | IPR002223 | - | 0.0 | - |
| Sma3 | ABC transporter-like | IPR003439 | - | 0.0 | - |
| Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
| Sma3 | Zinc finger, BED-type predicted | IPR003656 | - | 0.0 | - |
| Sma3 | ATPase, AAA-type, core | IPR003959 | - | 0.0 | - |
| Sma3 | Pleiotropic drug resistance protein PDR | IPR005285 | - | 0.0 | - |
| Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
| Sma3 | HAT dimerisation | IPR008906 | - | 0.0 | - |
| Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
| Sma3 | ABC-2 type transporter | IPR013525 | - | 0.0 | - |
| Sma3 | Plant PDR ABC transporter associated | IPR013581 | - | 0.0 | - |
| Sma3 | IPR015706 | - | 0.0 | - | |
| Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
| Sma3 | Peptidase S26A, signal peptidase I, serine active site | IPR019756 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G15210.1 | PDR7, ATPDR7 pleiotropic drug resistance 7 chr1:5231552-5236573 REVERSE LENGTH=1442 | 1.0e-34 | 82% |
| RefSeq | Arabidopsis thaliana | NP_172973.1 | ABC transporter G family member 35 [Arabidopsis thaliana] | 2.0e-34 | 82% |
| RefSeq | Populus trichocarpa | XP_002298123.1 | pleiotropic drug resistance, ABC transporter family protein, partial [Populus trichocarpa] | 7.0e-33 | 73% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LN70
Fln msg: Distance to subject end: 160 aas, your sequence is shorter than subject: 74 - 443
Fln protein:
R
Protein Length:
75
Fln nts:
T
Fln Alignment:
AllPine_a_c49993___GEITYNGHRLNEFVPQKTSAYISQHDLHVGEMTVRETIDFSARCQGVGDRYALLAELARREKQAGIFPEAEID
B8LN70________________GEVKYNGHALNEFVPERTSTYISQHDTHMGELTVRETLNFSARCQGVGSRYDVLTELSRREKQLGVKPDSDID

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta