UniGene Name: sp_v3.0_unigene115291
Length: 239 nt
UniGene Fasta |
---|
>sp_v3.0_unigene115291
T |
Ace file of the UniGene sp_v3.0_unigene115291 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | DNA-directed RNA polymerase (Fragment) n=2 Tax=Spermatophyta RepID=Q2TUM9_9CONI | - | - | 5.0e-31 | 100% |
FL-Next | sp=DNA-directed RNA polymerase; Sorghum bicolor (Sorghum) (Sorghum vulgare). | - | - | 0.0 | 82% |
Sma3 | DNA-directed RNA polymerase | - | - | 2.481e-22 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | DNA-directed RNA polymerase. | EC:2.7.7.6 | - | 1.1e-20 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Purine metabolism | 00230 | 1.1e-20 | % | |
Sma3 | Pyrimidine metabolism | 00240 | 1.1e-20 | % | |
Sma3 | Metabolic pathways | 01100 | 1.1e-20 | % |
Source | Gene names |
---|---|
Sma3 | GSVIVT00024436001; H0425E08.3; MICPUN_82079; OJ990528_30.3; OSIGBa0130B08.14; OSJNBa0076N16.24; OSTLU_24022; Os04g0492300; OsI_16437; Ot02g06220; PHYPADRAFT_177840; POPTRDRAFT_1068975; RCOM_1440440; rpc1; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | DNA-directed RNA polymerase activity | GO:0003899 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | ribonucleoside binding | GO:0032549 | Molecular Function | 0.0 | - |
Sma3 | GO:0006350 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | RNA polymerase, alpha subunit | IPR000722 | - | 0.0 | - |
Sma3 | RNA polymerase, N-terminal | IPR006592 | - | 0.0 | - |
Sma3 | RNA polymerase Rpb1, domain 3 | IPR007066 | - | 0.0 | - |
Sma3 | RNA polymerase Rpb1, domain 1 | IPR007080 | - | 0.0 | - |
Sma3 | RNA polymerase Rpb1, domain 5 | IPR007081 | - | 0.0 | - |
Sma3 | RNA polymerase Rpb1, domain 4 | IPR007083 | - | 0.0 | - |
Sma3 | TonB box, conserved site | IPR010916 | - | 0.0 | - |
Sma3 | DNA-directed RNA polymerase III largest subunit | IPR015700 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G60040.2 | NRPC1 nuclear RNA polymerase C1 chr5:24173590-24183269 FORWARD LENGTH=1391 | 5.0e-28 | 83% |
RefSeq | Arabidopsis thaliana | NP_001190573.1 | nuclear RNA polymerase C1 [Arabidopsis thaliana] | 6.0e-28 | 83% |
RefSeq | Populus trichocarpa | XP_002300065.1 | predicted protein [Populus trichocarpa] | 1.0e-27 | 80% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: tr_plants
Fln subject: C5YBD9
Fln msg: Overlapping hits, possible frame ERROR between 180 and 179, Distance to subject end: 795 aas, your sequence is shorter than subject: 80 - 1391
Fln protein:
S
Protein Length:
81
Fln nts:
T
Fln Alignment:
AllPine_a_c49944___KNGDILVASTQDFLTSSFLITRKDTFYDRASFALMCSYMGDATEAIDLPTPAILKPLELWTGKQLFSVLVRPNAN
C5YBD9________________KNGEILVASTQDFLTSSFLVTRKDTFYDRSSFTLLCSYLGDAMENIDLPTPALIKPIELWTGKQLFSVLVRPNAH
SNPs (tot: 2) |
---|
Position | A % | C % | G % | T % | Probability |
---|---|---|---|---|---|
57 | 66 | 33 | 0.997476 | ||
140 | 33 | 66 | 0.997476 |
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain