UniGene Name: sp_v3.0_unigene114918
Length: 222 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene114918
G |
Ace file of the UniGene sp_v3.0_unigene114918
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Subtilisin-like protease n=3 Tax=Andropogoneae RepID=B6SZ82_MAIZE | - | - | 5.0e-25 | 73% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 69% |
| Sma3 | Cucumisin, putative | - | - | 8.056e-39 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | 2-alkenal reductase. | EC:1.3.1.74 | - | 2.845e-09 | - |
| Sma3 | Cucumisin. | EC:3.4.21.25 | - | 0.0 | - |
| Source | Gene names |
|---|---|
| Sma3 | ARA12; ASP48; AT3G14067; AT4g34980; At1g04110; At2g05920; At3g14067; At3g14240; At4g34980; At5g03620; At5g51750; At5g59810/mmn10_30; At5g67360; F17C15_40; F20D22.12; GSVIVT00001051001; GSVIVT00001053001; GSVIVT00001054001; GSVIVT00001055001; GSVIVT0000107 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
| Sma3 | external side of plasma membrane | GO:0009897 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | serine-type endopeptidase activity | GO:0004252 | Molecular Function | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | identical protein binding | GO:0042802 | Molecular Function | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | plant-type cell wall modification | GO:0009827 | Biological Process | 0.0 | - |
| Sma3 | stomatal complex morphogenesis | GO:0010103 | Biological Process | 0.0 | - |
| Sma3 | regulation of cell proliferation | GO:0042127 | Biological Process | 0.0 | - |
| Sma3 | negative regulation of catalytic activity | GO:0043086 | Biological Process | 0.0 | - |
| Sma3 | mucilage metabolic process involved seed coat development | GO:0048359 | Biological Process | 0.0 | - |
| Sma3 | mucilage extrusion from seed coat | GO:0080001 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phosphofructokinase domain | IPR000023 | - | 0.0 | - |
| Sma3 | Ornithine/DAP/Arg decarboxylase | IPR000183 | - | 0.0 | - |
| Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
| Sma3 | Signal recognition particle, SRP54 subunit, GTPase | IPR000897 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
| Sma3 | Protease-associated domain, PA | IPR003137 | - | 0.0 | - |
| Sma3 | Proteinase inhibitor I9 | IPR010259 | - | 0.0 | - |
| Sma3 | TonB box, conserved site | IPR010916 | - | 0.0 | - |
| Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
| Sma3 | Peroxisome membrane protein, Pex16 | IPR013919 | - | 0.0 | - |
| Sma3 | Peptidase S8, subtilisin-related | IPR015500 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | Peroxidases heam-ligand binding site | IPR019793 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G67360.1 | ARA12 Subtilase family protein chr5:26872192-26874465 REVERSE LENGTH=757 | 1.0e-30 | 71% |
| RefSeq | Arabidopsis thaliana | NP_569048.1 | subtilisin-like protease [Arabidopsis thaliana] | 1.0e-30 | 71% |
| RefSeq | Populus trichocarpa | XP_002321861.1 | predicted protein [Populus trichocarpa] | 8.0e-30 | 68% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PPS1
Fln msg: Distance to subject end: 402 aas, your sequence is shorter than subject: 73 - 690
Fln protein:
D
Protein Length:
74
Fln nts:
G
Fln Alignment:
AllPine_a_c49481___DSDGHGTHTASTAAGNVMQGADVLGYAKGTATGMAPAARVAVYKVCWSQGCFESDIMAAMDTAVSDGVDVLSI
C0PPS1________________DQDGHGTHTASTAAGAVVLKADLVGYAKGTARGMATRARIAAYKVCWVGGCFSTDILAALDKAVADGVNVLSL

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta