UniGene Name: sp_v3.0_unigene114509
Length: 248 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene114509
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Kinase, putative n=2 Tax=Ricinus communis RepID=B9T4K4_RICCO | - | - | 4.0e-28 | 75% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 50% |
Sma3 | E3 ubiquitin ligase | - | - | 2.44e-18 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Non-specific protein-tyrosine kinase. | EC:2.7.10.2 | - | 4.104e-06 | - |
Sma3 | Transferases, Transferring phosphorous-containing groups, Protein-serine/threonine kinases. | EC:2.7.11.- | - | 2.713e-11 | - |
Sma3 | Ligases, Forming carbon-nitrogen bonds, Acid--D-amino-acid ligases (peptide synthases). | EC:6.3.2.- | - | 2.322e-06 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Tryptophan metabolism | 00380 | 2.322e-06 | % | |
Sma3 | Biosynthesis of siderophore group nonribosomal peptides | 01053 | 2.322e-06 | % |
Source | Gene names |
---|---|
Sma3 | 57h21.16; At1g17540; At1g78940/YUP8H12R_26; At2g07020; At2g19410; At2g24370; At2g45910; At3g20200; At3g20200/MAL21_24; At4g25160; At4g31230; At5g12000; At5g51270; At5g57035; At5g61550; At5g61560; B1097D05.17; CDPK1; CHLREDRAFT_116959; F13M23.300; F14F18_1 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | ubiquitin ligase complex | GO:0000151 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | ubiquitin-protein ligase activity | GO:0004842 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | response to stress | GO:0006950 | Biological Process | 0.0 | - |
Sma3 | protein ubiquitination | GO:0016567 | Biological Process | 0.0 | - |
Sma3 | modification-dependent protein catabolic process | GO:0019941 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G12000.1 | Protein kinase protein with adenine nucleotide alpha hydrolases-like domain chr5:3874151-3876780 REVERSE LENGTH=701 | 3.0e-34 | 71% |
RefSeq | Arabidopsis thaliana | NP_196761.2 | Protein kinase protein with adenine nucleotide alpha hydrolases-like domain [Arabidopsis thaliana] | 4.0e-34 | 71% |
RefSeq | Populus trichocarpa | XP_002324143.1 | predicted protein, partial [Populus trichocarpa] | 4.0e-33 | 74% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LPB1
Fln msg: Distance to subject end: 254 aas, your sequence is shorter than subject: 82 - 444
Fln protein:
N
Protein Length:
83
Fln nts:
A
Fln Alignment:
AllPine_a_c48960___VGEGSYGSVYKCTLDNSLVAVKALHPDASQGWKQFQQEVQVLSRIQHPHIV*LLGACPELGCLVYEYMSNGSLEDRL
B8LPB1________________IGEGCYGIVYKGQFHVTPVAIKLLKVNWFEGSSRFQREMDRLSSIKHPRLVMLMGACPDGGFIIYEYMPRGSLEDRL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain