|
||||||
|
UniGene Name: sp_v3.0_unigene114493
Length: 174 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene114493
A |
|
Ace file of the UniGene sp_v3.0_unigene114493
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | putative cation-transporting ATPase [Arabidopsis thaliana] sp|Q9LT02.1|ATY1_ARATH RecName: Full=Probable cation-transporting ATPase dbj|BAA97238.1| cation-transporting ATPase [Arabidopsis thaliana] gb|AED93192.1| putative cation-transporting ATPase [Arabi | - | - | 8.0e-22 | 75% |
| FL-Next | sp=Probable cation-transporting ATPase; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 75% |
| Sma3 | p-type ATPase transporter | - | - | 5.451e-09 | - |
| Source | Gene names |
|---|---|
| Sma3 | At5g23630; GSVIVT00003662001; MQM1.11; OSJNBb0006J12.7; Os05g0402800; OsI_19908; OsJ_18487; PHYPADRAFT_113743; POPTRDRAFT_247852; POPTRDRAFT_269210; RCOM_1761870; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism | GO:0015662 | Molecular Function | 0.0 | - |
| Sma3 | cation-transporting ATPase activity | GO:0019829 | Molecular Function | 0.0 | - |
| Sma3 | ATP biosynthetic process | GO:0006754 | Biological Process | 0.0 | - |
| Sma3 | cation transport | GO:0006812 | Biological Process | 0.0 | - |
| Sma3 | cellular metal ion homeostasis | GO:0006875 | Biological Process | 0.0 | - |
| Sma3 | pollen germination | GO:0009846 | Biological Process | 0.0 | - |
| Sma3 | pollen maturation | GO:0010152 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cof protein | IPR000150 | - | 0.0 | - |
| Sma3 | ATPase, P-type, K/Mg/Cd/Cu/Zn/Na/Ca/Na/H-transporter | IPR001757 | - | 0.0 | - |
| Sma3 | Haloacid dehalogenase-like hydrolase | IPR005834 | - | 0.0 | - |
| Sma3 | ATPase, P-type, unknown pump specificity (type V) | IPR006544 | - | 0.0 | - |
| Sma3 | ATPase, P-type, ATPase-associated domain | IPR008250 | - | 0.0 | - |
| Sma3 | ATPase, P-type phosphorylation site | IPR018303 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G23630.1 | PDR2, MIA phosphate deficiency response 2 chr5:7960756-7967644 REVERSE LENGTH=1179 | 1.0e-27 | 75% |
| RefSeq | Arabidopsis thaliana | NP_197752.1 | putative cation-transporting ATPase [Arabidopsis thaliana] | 2.0e-27 | 75% |
| RefSeq | Populus trichocarpa | XP_002330462.1 | p-type ATPase transporter, partial [Populus trichocarpa] | 5.0e-29 | 82% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9LT02
Fln msg: Distance to subject end: 959 aas, your sequence is shorter than subject: 58 - 1179
Fln protein:
T
Protein Length:
59
Fln nts:
A
Fln Alignment:
AllPine_a_c48936___TGYGSDTKVNAAVEKWGRNVFEFPQPTFQKLMKEHCMEPFFVFQVFCVCLWCLDEYY
Q9LT02________________TGHGTEAKIATATEKWGRNVFDYPQPTFQKLMKENCMEPFFVFQVFCVGLWCLDEFW
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
