SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene114424

Length: 366 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v3.0_unigene114424
ACGAGTACATGTCTCAAGGGTCTTTAAAGGAACAATCTTTATGGAGAGAAAGGCAGGACTTTCCAAACTAAATTGGAAAAGCAGGCTCAGAATAGCAATCGATGTGGCTGAGGCACTGCAATATCTGCACGTGTGTTGCATTCCAATGATAATTCACAGGAATGTGAAATCTTCAATCATCCTCCTCGACAGCGATTTGAATGGAAAATTAGGCGCTTTCGGTTTGTCGATGATGACAATGGATCGGAAGGCTCCTATCGAGGATATAGTGCAAGGAACTTACGGATACCTGGATCCAGAGTATGCTACGACTGGACAGTTCACCCAAAAGAGCGATGTATATGGTTTTGGTGTGGTTTTATTAGA

Ace file of the UniGene sp_v3.0_unigene114424 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	putative LRR receptor-like serine/threonine-protein kinase [Arabidopsis thaliana] sp\|C0LGV0.1\|Y5487_ARATH RecName: Full=Probable LRR receptor-like serine/threonine-protein kinase At5g48740; Flags: Precursor gb\|ACN59385.1\| leucine-rich repeat receptor-like	-	-	9.0e-24	59%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	45%
Sma3	Leucine-rich repeat receptor-like protein kinase	-	-	1.007e-26	-

Source	ECs	Term	Type	e value	Identity
Sma3	Mitogen-activated protein kinase kinase kinase.	EC:2.7.11.25	-	7.192e-07	-

Source	Gene names
Sma3	AT1G07560; AT1G31420; AT1G49730; AT1G51810; AT1G67720; AT1G79620; AT2G26330; AT2G28970; AT2G35620; AT2G37050; AT3G46330; AT4g29990; AT5G07180; AT5G48740; AT5G49760; AT5G49770; AT5G59650; AT5G62230; AT5G62710; At1g21240; At1g21250; At1g21270; At1g49730; At

Source	GOs	Term	Type	Identity
Sma3	mitochondrion	GO:0005739	Cellular Component	-
Sma3	vacuole	GO:0005773	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	plant-type cell wall	GO:0009505	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	proton-transporting ATP synthase complex, catalytic core F(1)	GO:0045261	Cellular Component	-
Sma3	protein kinase activity	GO:0004672	Molecular Function	-
Sma3	protein serine/threonine kinase activity	GO:0004674	Molecular Function	-
Sma3	protein tyrosine kinase activity	GO:0004713	Molecular Function	-
Sma3	receptor activity	GO:0004872	Molecular Function	-
Sma3	calcium ion binding	GO:0005509	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	oxidoreductase activity	GO:0016491	Molecular Function	-
Sma3	hydrogen ion transporting ATP synthase activity, rotational mechanism	GO:0046933	Molecular Function	-
Sma3	proton-transporting ATPase activity, rotational mechanism	GO:0046961	Molecular Function	-
Sma3	protein phosphorylation	GO:0006468	Biological Process	-
Sma3	cell surface receptor signaling pathway	GO:0007166	Biological Process	-
Sma3	oligosaccharide metabolic process	GO:0009311	Biological Process	-
Sma3	embryo sac development	GO:0009553	Biological Process	-
Sma3	response to salicylic acid stimulus	GO:0009751	Biological Process	-
Sma3	embryo development ending in seed dormancy	GO:0009793	Biological Process	-
Sma3	unidimensional cell growth	GO:0009826	Biological Process	-
Sma3	leaf morphogenesis	GO:0009965	Biological Process	-
Sma3	cellular water homeostasis	GO:0009992	Biological Process	-
Sma3	stomatal complex morphogenesis	GO:0010103	Biological Process	-
Sma3	ATP synthesis coupled proton transport	GO:0015986	Biological Process	-
Sma3	regulation of cell adhesion	GO:0030155	Biological Process	-
Sma3	ovule development	GO:0048481	Biological Process	-
Sma3	defense response to fungus	GO:0050832	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	EGF-type aspartate/asparagine hydroxylation site	IPR000152	-	-
Sma3	Protein kinase, catalytic domain	IPR000719	-	-
Sma3	Epidermal growth factor-like domain	IPR000742	-	-
Sma3	Beta-lactamase, class-A/D	IPR000871	-	-
Sma3	Serine-threonine/tyrosine-protein kinase catalytic domain	IPR001245	-	-
Sma3	ATPase, F1 complex, delta/epsilon subunit	IPR001469	-	-
Sma3	Leucine-rich repeat	IPR001611	-	-
Sma3	EGF-like calcium-binding	IPR001881	-	-
Sma3	Peptidase aspartic, active site	IPR001969	-	-
Sma3	Short-chain dehydrogenase/reductase SDR	IPR002198	-	-
Sma3	Serine/threonine- / dual-specificity protein kinase, catalytic domain	IPR002290	-	-
Sma3	Glucose/ribitol dehydrogenase	IPR002347	-	-
Sma3	Phosphopantetheine attachment site	IPR006162	-	-
Sma3	Epidermal growth factor-like	IPR006210	-	-
Sma3	Serine/threonine-protein kinase, active site	IPR008271	-	-
Sma3	EGF-like region, conserved site	IPR013032	-	-
Sma3		IPR013091	-	-
Sma3	Heat shock protein 70	IPR013126	-	-
Sma3	Leucine-rich repeat-containing N-terminal, type 2	IPR013210	-	-
Sma3	NAD(P)-binding domain	IPR016040	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3		IPR017442	-	-
Sma3	EGF-like calcium-binding, conserved site	IPR018097	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT5G48740.1	Leucine-rich repeat protein kinase family protein chr5:19765324-19769314 REVERSE LENGTH=895	5.0e-29	59%
RefSeq	Arabidopsis thaliana	NP_199685.2	putative LRR receptor-like serine/threonine-protein kinase [Arabidopsis thaliana]	7.0e-29	59%
RefSeq	Populus trichocarpa	XP_002326166.1	predicted protein [Populus trichocarpa]	4.0e-29	52%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LPH3

Fln msg: Distance to subject end: 92 aas, your sequence is shorter than subject: 121 - 360

Fln protein: RVHVSRVFKGTIFMERKAGLSKLNWKSRLRIAIDVAEALQYLHVCCIPMIIHRNVKSSIILLDSDLNGKLGAFGLSMMTMDRKAPIEDIVQGTYGYLDPEYATTGQFTQKSDVYGFGVVLL

Protein Length: 122

Fln nts: ACGAGTACATGTCTCAAGGGTCTTTAAAGGAACAATCTTTATGGAGAGAAAGGCAGGACTTTCCAAACTAAATTGGAAAAGCAGGCTCAGAATAGCAATCGATGTGGCTGAGGCACTGCAATATCTGCACGTGTGTTGCATTCCAATGATAATTCACAGGAATGTGAAATCTTCAATCATCCTCCTCGACAGCGATTTGAATGGAAAATTAGGCGCTTTCGGTTTGTCGATGATGACAATGGATCGGAAGGCTCCTATCGAGGATATAGTGCAAGGAACTTACGGATACCTGGATCCAGAGTATGCTACGACTGGACAGTTCACCCAAAAGAGCGATGTATATGGTTTTGGTGTGGTTTTATTAGA

Fln Alignment:

AllPine_a_c48844___IFMERKAGLSKLNWKSRLRIAIDVAEALQYLHVCCIPMIIHRNVKSSIILLDSDLNGKLGAFGLSMMTMDRKAPIEDIVQGTYGYLDPEYATTGQFTQKSDVYGFGVVLL
B8LPH3________________ILHSRSPNKVSLDWAARNKIALGSARGIAYLHHDCIPHIIHRDIKSSNILLDEEMEARISDFGLATLINPDQTHVSTIVAGTFGYLAPEYVETGRATEKGDVYSYGVVLL

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain