UniGene Name: sp_v3.0_unigene113724
Length: 190 nt
UniGene Fasta |
---|
>sp_v3.0_unigene113724
A |
Ace file of the UniGene sp_v3.0_unigene113724 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative chromatin remodeling protein SYD [Arabidopsis thaliana] | - | - | 2.0e-14 | 84% |
FL-Next | tr=Putative uncharacterized protein; Ricinus communis (Castor bean). | - | - | 0.0 | 87% |
Source | Gene names |
---|---|
Sma3 | At2g28290; CHR910; GSVIVT00019834001; OsI_22408; OsJ_20855; P0592E11.17-1; POPTRDRAFT_565767; POPTRDRAFT_766749; RCOM_0679520; SPLAYED; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
Sma3 | helicase activity | GO:0004386 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | response to wounding | GO:0009611 | Biological Process | 0.0 | - |
Sma3 | flower development | GO:0009908 | Biological Process | 0.0 | - |
Sma3 | organ boundary specification between lateral organs and the meristem | GO:0010199 | Biological Process | 0.0 | - |
Sma3 | regulation of gene expression, epigenetic | GO:0040029 | Biological Process | 0.0 | - |
Sma3 | ATP-dependent chromatin remodeling | GO:0043044 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | SNF2-related | IPR000330 | - | 0.0 | - |
Sma3 | HMG-I/HMG-Y, DNA-binding, conserved site | IPR000637 | - | 0.0 | - |
Sma3 | Helicase, C-terminal | IPR001650 | - | 0.0 | - |
Sma3 | Helicase, superfamily 1/2, ATP-binding domain | IPR014001 | - | 0.0 | - |
Sma3 | Helicase/SANT-associated, DNA binding | IPR014012 | - | 0.0 | - |
Sma3 | IPR014021 | - | 0.0 | - | |
Sma3 | Aldehyde dehydrogenase, conserved site | IPR016160 | - | 0.0 | - |
Sma3 | AT hook, DNA-binding motif | IPR017956 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G28290.1 | SYD, CHR3 P-loop containing nucleoside triphosphate hydrolases superfamily protein chr2:12056771-12072950 FORWARD LENGTH=3574 | 1.0e-16 | 84% |
RefSeq | Arabidopsis thaliana | NP_850116.1 | ATPase splayed [Arabidopsis thaliana] | 2.0e-16 | 84% |
RefSeq | Populus trichocarpa | XP_002311805.1 | chromatin remodeling complex subunit [Populus trichocarpa] | 9.0e-17 | 87% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: tr_plants
Fln subject: B9RSY8
Fln msg: Overlapping hits, possible frame ERROR between 100 and 97, Distance to subject end: 2568 aas, your sequence is shorter than subject: 63 - 3502
Fln protein:
A
Protein Length:
64
Fln nts:
A
Fln Alignment:
AllPine_a_c47989___HREKIERFQREKINLLKNNDVEGYLRMVQDTxMYRVKQLLKETERYLQKLGLKLREQKVRAR
B9RSY8________________HREKIDRIQREKINLLKINDVEGYLRMVQDAxSDRVKQLLKETEKYLQKLGSKLQDAKVMAK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain