SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene113146

Length: 141 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v3.0_unigene113146
GTCATGCAGCTGGTTGAATTAGATGATCTGAGAGATGCTCTAGTTGGCATTCCTGGTGTCAGTGGTTTATCTGCTGGGCAACGCAAAAGATTGACAATTGCTGTAGAGCTTGTCACAAATCCTTCTATCATATTCATGGAT

Ace file of the UniGene sp_v3.0_unigene113146 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	PDR-like ABC transporter n=4 Tax=Oryza sativa RepID=Q8GU83_ORYSJ	-	-	8.0e-14	80%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	85%
Sma3	ATP-binding cassette transporter, putative	-	-	0.0	-

Source	ECs	Term	Type	e value	Identity
Sma3	Phosphonate-transporting ATPase.	EC:3.6.3.28	-	1.4013e-45	-
Sma3	Heme-transporting ATPase.	EC:3.6.3.41	-	1.201e-10	-

Source	Gene names
Sma3	ABC1; ABC2; ABC3; ABC4; At1g15210; At1g15520; At1g59870; At1g66950; At2g26910; At2g29940; At2g36380; At2g37280; At3g16340; At3g30842; At3g53480; At4g15215; At4g15220/At4g15230; At4g15233; At4g15236; B1045F02.15; B1090H08.39; CHLREDRAFT_115842; CHLREDRAFT_

Source	GOs	Term	Type	Identity
Sma3	chromatin	GO:0000785	Cellular Component	-
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	mitochondrion	GO:0005739	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	chloroplast envelope	GO:0009941	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	chromatin binding	GO:0003682	Molecular Function	-
Sma3	RNA binding	GO:0003723	Molecular Function	-
Sma3	RNA-directed DNA polymerase activity	GO:0003964	Molecular Function	-
Sma3	aspartic-type endopeptidase activity	GO:0004190	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	zinc ion binding	GO:0008270	Molecular Function	-
Sma3	cadmium ion transmembrane transporter activity	GO:0015086	Molecular Function	-
Sma3	ATPase activity	GO:0016887	Molecular Function	-
Sma3	protein dimerization activity	GO:0046983	Molecular Function	-
Sma3	RNA-dependent DNA replication	GO:0006278	Biological Process	-
Sma3	chromatin assembly or disassembly	GO:0006333	Biological Process	-
Sma3	proteolysis	GO:0006508	Biological Process	-
Sma3	transport	GO:0006810	Biological Process	-
Sma3	defense response	GO:0006952	Biological Process	-
Sma3	response to biotic stimulus	GO:0009607	Biological Process	-
Sma3	systemic acquired resistance	GO:0009627	Biological Process	-
Sma3	response to ethylene stimulus	GO:0009723	Biological Process	-
Sma3	response to salicylic acid stimulus	GO:0009751	Biological Process	-
Sma3	response to jasmonic acid stimulus	GO:0009753	Biological Process	-
Sma3	defense response to fungus, incompatible interaction	GO:0009817	Biological Process	-
Sma3	response to ozone	GO:0010193	Biological Process	-
Sma3	cadmium ion transport	GO:0015691	Biological Process	-
Sma3	lead ion transport	GO:0015692	Biological Process	-
Sma3	negative regulation of defense response	GO:0031348	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Reverse transcriptase	IPR000477	-	-
Sma3	Ribosomal protein L11	IPR000911	-	-
Sma3	Chromo domain/shadow	IPR000953	-	-
Sma3	Zinc finger, CCHC-type	IPR001878	-	-
Sma3	Peptidase aspartic, active site	IPR001969	-	-
Sma3	DNA methylase, N-6 adenine-specific, conserved site	IPR002052	-	-
Sma3	Proteinase inhibitor I2, Kunitz metazoa	IPR002223	-	-
Sma3	ABC transporter-like	IPR003439	-	-
Sma3	AAA+ ATPase domain	IPR003593	-	-
Sma3	ATPase, AAA-type, core	IPR003959	-	-
Sma3	Retrotransposon gag protein	IPR005162	-	-
Sma3	Pleiotropic drug resistance protein PDR	IPR005285	-	-
Sma3	Phosphopantetheine attachment site	IPR006162	-	-
Sma3	Domain of unknown function DUF659	IPR007021	-	-
Sma3	HAT dimerisation	IPR008906	-	-
Sma3	Retroviral aspartyl protease	IPR013242	-	-
Sma3	ABC-2 type transporter	IPR013525	-	-
Sma3	Plant PDR ABC transporter associated	IPR013581	-	-
Sma3	ABC transporter, conserved site	IPR017871	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT1G15210.1	PDR7, ATPDR7 pleiotropic drug resistance 7 chr1:5231552-5236573 REVERSE LENGTH=1442	4.0e-18	82%
RefSeq	Arabidopsis thaliana	NP_172973.1	ABC transporter G family member 35 [Arabidopsis thaliana]	5.0e-18	82%
RefSeq	Populus trichocarpa	XP_002304712.1	predicted protein [Populus trichocarpa]	4.0e-18	82%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LPF4

Fln msg: Distance to subject end: 121 aas, your sequence is shorter than subject: 47 - 283

Fln protein: VMQLVELDDLRDALVGIPGVSGLSAGQRKRLTIAVELVTNPSIIFMD

Protein Length: 48

Fln nts: GTCATGCAGCTGGTTGAATTAGATGATCTGAGAGATGCTCTAGTTGGCATTCCTGGTGTCAGTGGTTTATCTGCTGGGCAACGCAAAAGATTGACAATTGCTGTAGAGCTTGTCACAAATCCTTCTATCATATTCATGGAT

Fln Alignment:

AllPine_a_c47282___VMQLVELDDLRDALVGIPGVSGLSAGQRKRLTIAVELVTNPSIIFMD
B8LPF4________________VMQLLELDDLKDVVVGIPGVSGLSTEQRKRLTIAVELVANPSIIFMD

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain