SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene112943

Length: 284 nt

UniGene Fasta

>sp_v3.0_unigene112943
AATGTTTGATTTAGATGTAGCAGTGGGGAATGCACTGATAGACATGTATGCAAAATGTGGGTGTTTAGAGGATGCACATCGAGTGTTTCGGAAGATGTCTCAAGCGAATGTTATCTCATGGACTGCGATGATTTCAGGATTTGGTTTGCATGGTCGTGGTGAGGATGCTGTGGGGCTTTTCCACCAAATGCAAGAGCTAGGCATGAGGCCAAATGATGTCACCTTCACTGCTGTTTTGTCAGCTTGCAGTCATGCAGGTCTTGTAGATAAGGGCTGGCGAAATT

Ace file of the UniGene sp_v3.0_unigene112943

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	pentatricopeptide repeat-containing protein [Arabidopsis thaliana] sp\|Q7Y211.2\|PP285_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g57430, chloroplastic; Flags: Precursor gb\|AEE79654.1\| pentatricopeptide repeat-containing protein [Ara	-	-	7.0e-24	52%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	58%
Sma3	Pentatricopeptide repeat-containing protein, putative	-	-	5.62801e-40	-

Source	Gene names
Sma3	At1g25360; At1g28690; At1g50270; At1g56570; At2g03880; At2g13600; At2g33680; At2g33760; At3g15930; At3g16610; At3g20730; At3g26782; At3g49140; At3g49170; At3g57430; At4g16470; At5g13270; At5g15340; At5g66520; B1032F05.19; EMB2261; F14I3.12; F1K23.11; F25P

Source	GOs	Term	Type	Identity
Sma3	mitochondrion	GO:0005739	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	diacylglycerol kinase activity	GO:0004143	Molecular Function	-
Sma3	protein kinase activity	GO:0004672	Molecular Function	-
Sma3	binding	GO:0005488	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	methyltransferase activity	GO:0008168	Molecular Function	-
Sma3	deaminase activity	GO:0019239	Molecular Function	-
Sma3	protein phosphorylation	GO:0006468	Biological Process	-
Sma3	activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway	GO:0007205	Biological Process	-
Sma3	metabolic process	GO:0008152	Biological Process	-
Sma3	purine ribonucleoside monophosphate biosynthetic process	GO:0009168	Biological Process	-
Sma3	embryo development ending in seed dormancy	GO:0009793	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	PAK-box/P21-Rho-binding	IPR000095	-	-
Sma3	Ribonuclease P	IPR000100	-	-
Sma3		IPR000173	-	-
Sma3	Peptidase S8/S53, subtilisin/kexin/sedolisin	IPR000209	-	-
Sma3	Protein kinase, catalytic domain	IPR000719	-	-
Sma3	Diacylglycerol kinase, accessory domain	IPR000756	-	-
Sma3	Beta-lactamase, class-A/D	IPR000871	-	-
Sma3	Diacylglycerol kinase, catalytic domain	IPR001206	-	-
Sma3	Legume lectin domain	IPR001220	-	-
Sma3	Adenosine/AMP deaminase domain	IPR001365	-	-
Sma3	Kinesin, motor domain	IPR001752	-	-
Sma3	F-box domain, cyclin-like	IPR001810	-	-
Sma3	Pentatricopeptide repeat	IPR002885	-	-
Sma3	Tetratricopeptide-like helical	IPR011990	-	-
Sma3	Methyltransferase type 11	IPR013216	-	-
Sma3		IPR017442	-	-
Sma3	Asp/Glu racemase, active site	IPR018187	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT3G57430.1	OTP84 Tetratricopeptide repeat (TPR)-like superfamily protein chr3:21255731-21258403 REVERSE LENGTH=890	1.0e-29	52%
RefSeq	Arabidopsis thaliana	NP_191302.2	pentatricopeptide repeat-containing protein [Arabidopsis thaliana]	2.0e-29	52%
RefSeq	Populus trichocarpa	XP_002306238.1	predicted protein [Populus trichocarpa]	2.0e-33	53%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: A9P0W0

Fln msg: Distance to subject end: 249 aas, your sequence is shorter than subject: 94 - 370

Fln protein: MFDLDVAVGNALIDMYAKCGCLEDAHRVFRKMSQANVISWTAMISGFGLHGRGEDAVGLFHQMQELGMRPNDVTFTAVLSACSHAGLVDKGWRN

Protein Length: 95

Fln nts: AATGTTTGATTTAGATGTAGCAGTGGGGAATGCACTGATAGACATGTATGCAAAATGTGGGTGTTTAGAGGATGCACATCGAGTGTTTCGGAAGATGTCTCAAGCGAATGTTATCTCATGGACTGCGATGATTTCAGGATTTGGTTTGCATGGTCGTGGTGAGGATGCTGTGGGGCTTTTCCACCAAATGCAAGAGCTAGGCATGAGGCCAAATGATGTCACCTTCACTGCTGTTTTGTCAGCTTGCAGTCATGCAGGTCTTGTAGATAAGGGCTGGCGAAATT

Fln Alignment:

AllPine_a_c47034___FDLDVAVGNALIDMYAKCGCLEDAHRVFRKMSQANVISWTAMISGFGLHGRGEDAVGLFHQMQELGMRPNDVTFTAVLSACSHAGLVDKG
A9P0W0________________FELDVSVSNGLVDMYGKCGRIEDAQEVFSKLLEPDVASWNAMISGLAQHGCGKEAVLLFEQMLQTGVKPNQITFVVVLSGCSHAGLVDEG

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain