|
||||||
|
UniGene Name: sp_v3.0_unigene112647
Length: 244 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene112647
T |
|
Ace file of the UniGene sp_v3.0_unigene112647
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Kinase-like protein (Fragment) n=1 Tax=Corylus avellana RepID=C7A7W5_CORAV | - | - | 3.0e-20 | 61% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 58% |
| Sma3 | Putative S-receptor kinase | - | - | 2.164e-13 | - |
| Source | Gene names |
|---|---|
| Sma3 | 17L07.5; AT4g32300; At1g34300; At2g19130; At4g32300; At5g35370; B1099D03.46; B1099D03.51; B1423D04.25; DUPR11.18; F10M6.60; F23M19.5; F8B4.10; GSVIVT00000338001; GSVIVT00001733001; GSVIVT00001735001; GSVIVT00015350001; GSVIVT00016916001; GSVIVT00017302001 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | peptidoglycan-based cell wall | GO:0009274 | Cellular Component | 0.0 | - |
| Sma3 | cell surface | GO:0009986 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | thylakoid membrane | GO:0042651 | Cellular Component | 0.0 | - |
| Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
| Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | plastoquinol--plastocyanin reductase activity | GO:0009496 | Molecular Function | 0.0 | - |
| Sma3 | 2 iron, 2 sulfur cluster binding | GO:0051537 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | peptidoglycan biosynthetic process | GO:0009252 | Biological Process | 0.0 | - |
| Sma3 | recognition of pollen | GO:0048544 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G32300.1 | SD2-5 S-domain-2 5 chr4:15599970-15602435 FORWARD LENGTH=821 | 4.0e-24 | 60% |
| RefSeq | Arabidopsis thaliana | NP_194957.2 | protein S-DOMAIN-2 5 [Arabidopsis thaliana] | 5.0e-24 | 60% |
| RefSeq | Populus trichocarpa | XP_002317112.1 | predicted protein [Populus trichocarpa] | 6.0e-25 | 64% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NM60
Fln msg: Distance to subject end: 222 aas, your sequence is shorter than subject: 80 - 431
Fln protein:
Y
Protein Length:
81
Fln nts:
T
Fln Alignment:
AllPine_a_c46657___YEGVLKDKTGVAVKKL-DGPRQGYREFRAEVATIGSISHMNLVRLRGFCADSRQRLLVYELMENGSLEKWLF
A9NM60________________YEGILEDDTLVAVKCLVNESRQGQAEFCAEIGTTSSINHSNLVRLHGICVEGQHRILVYEFMANGSLDRWLF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
