|
||||||
|
UniGene Name: sp_v3.0_unigene111111
Length: 243 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene111111
T |
|
Ace file of the UniGene sp_v3.0_unigene111111
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | SET domain protein (Fragment) n=1 Tax=Populus trichocarpa RepID=B9I5A8_POPTR | - | - | 3.0e-27 | 67% |
| FL-Next | sp=Histone-lysine N-methyltransferase ATX4; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 63% |
| Sma3 | Trithorax, putative | - | - | 1.362e-08 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Histone-lysine N-methyltransferase. | EC:2.1.1.43 | - | 2.015e-13 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Lysine degradation | 00310 | 2.015e-13 | % |
| Source | Gene names |
|---|---|
| Sma3 | ATX3; ATX4; ATX5; At3g61740; At4g27910; At5g53430; F15G16.130; GSVIVT00027049001; GSVIVT00037113001; MYN8.4; Os01g0218800; OsI_00917; OsI_03117; OsJ_00897; OsJ_02868; P0489G09.14; POPTRDRAFT_250990; POPTRDRAFT_421736; POPTRDRAFT_755391; RCOM_0718450; RCOM |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | histone-lysine N-methyltransferase activity | GO:0018024 | Molecular Function | 0.0 | - |
| Sma3 | DNA mediated transformation | GO:0009294 | Biological Process | 0.0 | - |
| Sma3 | chromatin modification | GO:0016568 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | PWWP | IPR000313 | - | 0.0 | - |
| Sma3 | SET domain | IPR001214 | - | 0.0 | - |
| Sma3 | Zinc finger, PHD-type | IPR001965 | - | 0.0 | - |
| Sma3 | ABC transporter-like | IPR003439 | - | 0.0 | - |
| Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
| Sma3 | Post-SET domain | IPR003616 | - | 0.0 | - |
| Sma3 | ABC transporter, N-terminal | IPR010509 | - | 0.0 | - |
| Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
| Sma3 | ABC transporter, integral membrane type 1 | IPR017940 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G27910.1 | ATX4, SDG16 SET domain protein 16 chr4:13894694-13900256 FORWARD LENGTH=1027 | 3.0e-32 | 63% |
| RefSeq | Arabidopsis thaliana | NP_194520.3 | histone-lysine N-methyltransferase ATX4 [Arabidopsis thaliana] | 4.0e-32 | 63% |
| RefSeq | Populus trichocarpa | XP_002318412.1 | SET domain protein, partial [Populus trichocarpa] | 9.0e-34 | 67% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9SUE7
Fln msg: Distance to subject end: 288 aas, your sequence is shorter than subject: 80 - 1027
Fln protein:
K
Protein Length:
81
Fln nts:
T
Fln Alignment:
AllPine_a_c44783___KPTTTGQCWVHVTCAWFASVVSFVNDKTMEPADGILKIDARSFRKVCIICKQMHGSCIQCCKCHKSYHAMCASKAGYRME
Q9SUE7________________KPTDVETLWVHVTCAWFQPEVCFASEEKMEPAVGILSIPSTNFVKICVICKQIHGSCTQCCKCSTYYHAMCASRAGYRME
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
