UniGene Name: sp_v3.0_unigene110958
Length: 224 nt
UniGene Fasta |
---|
>sp_v3.0_unigene110958
G |
Ace file of the UniGene sp_v3.0_unigene110958 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | protein kinase family protein [Arabidopsis thaliana] dbj|BAB09338.1| serine/threonine-specific protein kinase-like protein [Arabidopsis thaliana] gb|AED96515.1| protein kinase family protein [Arabidopsis thaliana] | - | - | 4.0e-20 | 76% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 80% |
Sma3 | Serine/threonine-specific protein kinase-like protein | - | - | 1.339e-07 | - |
Source | Gene names |
---|---|
Sma3 | At5g15730; At5g54590; F14F8_110; GSVIVT00005346001; GSVIVT00027443001; GSVIVT00038097001; In29; NaRLK9; OJ1119_D01.12; OSJNBa0021H05.27; Os01g0960400; Os06g0283300; Os08g0138700; OsI_05296; OsI_22555; OsI_27753; OsJ_04842; OsJ_20986; OsJ_25984; P0401G10.2 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
Sma3 | Zinc finger, RING-type | IPR001841 | - | 0.0 | - |
Sma3 | Zinc finger, PHD-type | IPR001965 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Leucine-rich repeat-containing N-terminal, type 2 | IPR013210 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | Zinc finger, RING-type, conserved site | IPR017907 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G54590.2 | CRLK1 Protein kinase superfamily protein chr5:22180480-22182698 FORWARD LENGTH=440 | 3.0e-26 | 76% |
RefSeq | Arabidopsis thaliana | NP_851189.1 | protein kinase family protein [Arabidopsis thaliana] | 1.0e-26 | 76% |
RefSeq | Populus trichocarpa | XP_002316964.1 | predicted protein [Populus trichocarpa] | 4.0e-27 | 80% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LL62
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 200 aas, your sequence is shorter than subject: 74 - 443
Fln protein:
E
Protein Length:
75
Fln nts:
G
Fln Alignment:
AllPine_a_c44592___EFQTEVMLLGRLHHRNLVNLVGYCAEKGHRMLIYEFMSNGSLATRLYDESLEPLNWERRV
B8LL62________________EFQTEVMLLGRLHHRNLVNLVGYCVDKGERMLVYEFMSNGSLATHLYDKDARILSWEERV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain