UniGene Name: sp_v3.0_unigene110928
Length: 225 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene110928
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Ubiquitin-activating enzyme E1 n=2 Tax=Physcomitrella patens subsp. patens RepID=A9REZ6_PHYPA | - | - | 2.0e-22 | 74% |
FL-Next | sp=Ubiquitin-activating enzyme E1 3; Triticum aestivum (Wheat). | - | - | 0.0 | 73% |
Sma3 | Ubiquitin-activating enzyme E1 | - | - | 0.0 | - |
Source | Gene names |
---|---|
Sma3 | At2g30110; At5g06460; CHLREDRAFT_191903; GSVIVT00001293001; GSVIVT00024047001; LOC_Os03g18380; LOC_Os11g01510; LOC_Os12g01520; MICPUCDRAFT_30909; OSTLU_35452; Os03g0294900; Os07g0692900; Os11g0106400; OsI_27435; OsI_34806; OsI_37167; OsJ_10472; OsJ_25682; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
Sma3 | ubiquitin-protein ligase activity | GO:0004842 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | small protein activating enzyme activity | GO:0008641 | Molecular Function | 0.0 | - |
Sma3 | ligase activity | GO:0016874 | Molecular Function | 0.0 | - |
Sma3 | protein modification process | GO:0006464 | Biological Process | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | protein ubiquitination | GO:0016567 | Biological Process | 0.0 | - |
Sma3 | modification-dependent protein catabolic process | GO:0019941 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Sma3 | response to other organism | GO:0051707 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ubiquitin/SUMO-activating enzyme E1 | IPR000011 | - | 0.0 | - |
Sma3 | Ubiquitin-activating enzyme repeat | IPR000127 | - | 0.0 | - |
Sma3 | UBA/THIF-type NAD/FAD binding fold | IPR000594 | - | 0.0 | - |
Sma3 | RNA polymerase, alpha subunit | IPR000722 | - | 0.0 | - |
Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
Sma3 | Ubiquitin-activating enzyme, E1, active site | IPR018074 | - | 0.0 | - |
Sma3 | Ubiquitin-activating enzyme, E1 | IPR018075 | - | 0.0 | - |
Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G06460.1 | ATUBA2, UBA 2 ubiquitin activating enzyme 2 chr5:1970239-1974382 FORWARD LENGTH=1077 | 1.0e-26 | 75% |
RefSeq | Arabidopsis thaliana | NP_568168.1 | ubiquitin-activating enzyme E1 2 [Arabidopsis thaliana] | 1.0e-26 | 75% |
RefSeq | Populus trichocarpa | XP_002313232.1 | predicted protein, partial [Populus trichocarpa] | 4.0e-27 | 75% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: P31252
Fln msg: Distance to subject end: 560 aas, your sequence is shorter than subject: 74 - 1053
Fln protein:
I
Protein Length:
75
Fln nts:
A
Fln Alignment:
AllPine_a_c44559___QFFYFDSLESLPKHPLRPEDIMPLNCRYDAQISVFGTNLQKILEESNVFVVGAGALGCEFLKNL
P31252________________QFFYFDSVESLPTYPLEPQDLKPSNNRYDAQVSVFGSKLQKKMEEANTFVVGSGALGCEFLKNL
![]() |
---|
Position | A % | C % | G % | T % | Probability |
---|---|---|---|---|---|
184 | 33 | 66 | 0.997458 | ||
186 | 66 | 33 | 0.997464 | ||
187 | 66 | 33 | 0.997464 |
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain