UniGene Name: sp_v3.0_unigene110858
Length: 188 nt
UniGene Fasta |
---|
>sp_v3.0_unigene110858
T |
Ace file of the UniGene sp_v3.0_unigene110858 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | P-type ATPase [Hordeum vulgare] | - | - | 8.0e-20 | 66% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 68% |
Sma3 | Endoplasmic reticulum [ER]-type calcium ATPase | - | - | 5.06e-10 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Calcium-transporting ATPase. | EC:3.6.3.8 | - | 9.418e-10 | - |
Source | Gene names |
---|---|
Sma3 | ACA3; ACA5; A_TM018A10.4; At1g07670; At1g07810; At4g00900; CA6; CA7; CHLREDRAFT_77047; ECA1; ECA2; ECA4; F24B9.9; GSVIVT00008659001; GSVIVT00024422001; LCA1; LOC_Os03g17310; OSTLU_29095; Os05g0120700; OsI_11041; OsI_18241; OsJ_10376; OsJ_16928; PHYPADRAFT |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | integral to endoplasmic reticulum membrane | GO:0030176 | Cellular Component | 0.0 | - |
Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
Sma3 | calcium-transporting ATPase activity | GO:0005388 | Molecular Function | 0.0 | - |
Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism | GO:0015662 | Molecular Function | 0.0 | - |
Sma3 | ATP biosynthetic process | GO:0006754 | Biological Process | 0.0 | - |
Sma3 | cation transport | GO:0006812 | Biological Process | 0.0 | - |
Sma3 | calcium ion transport | GO:0006816 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | ATPase, P-type, H+ transporting proton pump | IPR000695 | - | 0.0 | - |
Sma3 | ATPase, P-type, K/Mg/Cd/Cu/Zn/Na/Ca/Na/H-transporter | IPR001757 | - | 0.0 | - |
Sma3 | ATPase, P-type cation-transporter, N-terminal | IPR004014 | - | 0.0 | - |
Sma3 | ATPase, P-type, calcium-transporting | IPR005782 | - | 0.0 | - |
Sma3 | Haloacid dehalogenase-like hydrolase | IPR005834 | - | 0.0 | - |
Sma3 | ATPase, P-type cation-transporter, C-terminal | IPR006068 | - | 0.0 | - |
Sma3 | ATPase, P-type cation exchange, alpha subunit | IPR006069 | - | 0.0 | - |
Sma3 | ATPase, P-type, ATPase-associated domain | IPR008250 | - | 0.0 | - |
Sma3 | ATPase, P-type phosphorylation site | IPR018303 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G07670.1 | ATECA4, ECA4 endomembrane-type CA-ATPase 4 chr1:2370305-2374196 REVERSE LENGTH=1061 | 3.0e-24 | 65% |
RefSeq | Arabidopsis thaliana | NP_172246.3 | Ca2+-transporting ATPase [Arabidopsis thaliana] | 4.0e-24 | 65% |
RefSeq | Populus trichocarpa | XP_002320213.1 | endoplasmic reticulum [ER]-type calcium ATPase [Populus trichocarpa] | 2.0e-25 | 70% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AEI1
Fln msg: Distance to subject end: 142 aas, your sequence is shorter than subject: 62 - 340
Fln protein:
N
Protein Length:
63
Fln nts:
T
Fln Alignment:
AllPine_a_c44466___NDALINAWVFFRYMVIGLYVGVATVGIFTLWYTHDSVFGIDFFADEHTLVTFSQLRSWGEC
D5AEI1________________NDSLIDAWVLFRYLVIGLYVGLATVGIFAIWYTHESFLGISLVGDGHTLVSFSQLRTWDQC
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain