UniGene Name: sp_v3.0_unigene110685
Length: 142 nt
UniGene Fasta |
---|
>sp_v3.0_unigene110685
T |
Ace file of the UniGene sp_v3.0_unigene110685 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | carbamoyl phosphate synthetase B [Arabidopsis thaliana] gb|AAG10606.1|AC008030_6 carbamoyl phosphate synthetase large chain (carB) [Arabidopsis thaliana] gb|AAK56257.1|AF367268_1 At1g29900/F1N18_6 [Arabidopsis thaliana] gb|AAB67843.1| carbamoyl phosphate | - | - | 1.0e-18 | 97% |
FL-Next | tr=Putative uncharacterized protein; Vitis vinifera (Grape). | - | - | 0.0 | 97% |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Carbamoyl-phosphate synthase (ammonia). | EC:6.3.4.16 | - | 1.262e-08 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Alanine, aspartate and glutamate metabolism | 00250 | 1.262e-08 | % | |
Sma3 | Arginine and proline metabolism | 00330 | 1.262e-08 | % | |
Sma3 | Nitrogen metabolism | 00910 | 1.262e-08 | % | |
Sma3 | Metabolic pathways | 01100 | 1.262e-08 | % | |
Sma3 | Carbamoyl-phosphate synthase (glutamine-hydrolyzing). | EC:6.3.5.5 | - | 4.024e-10 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Pyrimidine metabolism | 00240 | 4.024e-10 | % | |
Sma3 | Alanine, aspartate and glutamate metabolism | 00250 | 4.024e-10 | % | |
Sma3 | Metabolic pathways | 01100 | 4.024e-10 | % |
Source | Gene names |
---|---|
Sma3 | At1g29900; CARB; CHLREDRAFT_195255; CMPL1; CPS; CPS-II; CPSl; CT4; F1N18.6; GSVIVT00024476001; MICPUCDRAFT_16722; MICPUN_104797; OSTLU_42572; OsJ_02282; PHATRDRAFT_39528; PHYPADRAFT_151733; PHYPADRAFT_180534; POPTRDRAFT_1089355; POPTRDRAFT_277303; PYR1L; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | carbamoyl-phosphate synthase activity | GO:0004086 | Molecular Function | 0.0 | - |
Sma3 | carbamoyl-phosphate synthase (ammonia) activity | GO:0004087 | Molecular Function | 0.0 | - |
Sma3 | carbamoyl-phosphate synthase (glutamine-hydrolyzing) activity | GO:0004088 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | nitrogen compound metabolic process | GO:0006807 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G29900.1 | CARB carbamoyl phosphate synthetase B chr1:10468164-10471976 FORWARD LENGTH=1187 | 4.0e-24 | 97% |
RefSeq | Arabidopsis thaliana | NP_564338.1 | carbamoyl phosphate synthetase B [Arabidopsis thaliana] | 6.0e-24 | 97% |
RefSeq | Populus trichocarpa | XP_002314458.1 | predicted protein [Populus trichocarpa] | 3.0e-23 | 93% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: tr_plants
Fln subject: F6GTX9
Fln msg: Distance to subject end: 497 aas, your sequence is shorter than subject: 46 - 1188
Fln protein:
M
Protein Length:
47
Fln nts:
T
Fln Alignment:
AllPine_a_c44252___MILGAGPIVIGQACEFDYSGTQACKALKEEGYEVILINSNPATIMT
F6GTX9________________MILGAGPIVIGQACEFDYSGTQACKALKEEGYEVVLINSNPATIMT
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain