|
||||||
|
UniGene Name: sp_v3.0_unigene110535
Length: 193 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene110535
G |
|
Ace file of the UniGene sp_v3.0_unigene110535
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Homeodomain transcription factor n=1 Tax=Cucumis melo subsp. melo RepID=E5GB81_CUCME | - | - | 1.0e-13 | 83% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 90% |
| Sma3 | Protein WUSCHEL | - | - | 8.858e-15 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g46480; At2g01500; At2g17950; At2g28610; At3g18010; At5g59340; GSVIVT00014862001; GSVIVT00017818001; GSVIVT00024355001; GSVIVT00024432001; GSVIVT00030507001; GSVIVT00036791001; H0212B02.3; LOC_Os04g56780; MEB5.20; MEB5.23; NS1; NS2; OSIGBa0099L20.6; OS |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | primary endosperm nucleus | GO:0048353 | Cellular Component | 0.0 | - |
| Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
| Sma3 | sequence-specific DNA binding | GO:0043565 | Molecular Function | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | multicellular organismal development | GO:0007275 | Biological Process | 0.0 | - |
| Sma3 | positive regulation of cell proliferation | GO:0008284 | Biological Process | 0.0 | - |
| Sma3 | embryonic pattern specification | GO:0009880 | Biological Process | 0.0 | - |
| Sma3 | flower development | GO:0009908 | Biological Process | 0.0 | - |
| Sma3 | longitudinal axis specification | GO:0009942 | Biological Process | 0.0 | - |
| Sma3 | cell differentiation | GO:0030154 | Biological Process | 0.0 | - |
| Sma3 | cotyledon development | GO:0048825 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Fumarate lyase | IPR000362 | - | 0.0 | - |
| Sma3 | Homeodomain | IPR001356 | - | 0.0 | - |
| Sma3 | TonB box, conserved site | IPR010916 | - | 0.0 | - |
| Sma3 | IPR012287 | - | 0.0 | - | |
| Sma3 | Homeobox, conserved site | IPR017970 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G46480.1 | WOX4 WUSCHEL related homeobox 4 chr1:17236903-17237953 REVERSE LENGTH=251 | 5.0e-19 | 69% |
| RefSeq | Arabidopsis thaliana | NP_175145.2 | WUSCHEL-related homeobox 4 [Arabidopsis thaliana] | 7.0e-19 | 69% |
| RefSeq | Populus trichocarpa | XP_002301170.1 | predicted protein [Populus trichocarpa] | 7.0e-18 | 78% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LN48
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 264 aas, your sequence is shorter than subject: 51 - 481
Fln protein:
M
Protein Length:
52
Fln nts:
G
Fln Alignment:
AllPine_a_c44057___MRTPNAEQIEHITAQLRQYGKIEGKNVFYWFQNHKARESRSK
B8LN48________________MRTPNAEQIEHITAQLRQYGKIEGKNVFYWFQNHKARERQKQ
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
