UniGene Name: sp_v3.0_unigene110276
Length: 202 nt
![]() |
---|
>sp_v3.0_unigene110276
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Glutamate receptor (Fragment) n=2 Tax=Vitis vinifera RepID=D7SWB7_VITVI | - | - | 1.0e-19 | 64% |
FL-Next | sp=Glutamate receptor 3.6; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 62% |
Sma3 | Glutamate-gated kainate-type ion channel receptor subunit GluR5 | - | - | 1.345e-17 | - |
Source | Gene names |
---|---|
Sma3 | AT1G05200; At1g05200; At1g42540; At2g32390; At3g51480; F26O13.120; GLR3.1; GLR3.3; GLR3.4; GLR3.5; GLR3.6; GLR4; GLR6; GLUR3; GSVIVT00002906001; GSVIVT00019331001; GSVIVT00026034001; H0307D04.1; LOC_Os04g49570; OJ1372_D12.115; OSJNBa0013K16.8; Os04g058520 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | G-protein coupled receptor activity | GO:0004930 | Molecular Function | 0.0 | - |
Sma3 | G-protein coupled GABA receptor activity | GO:0004965 | Molecular Function | 0.0 | - |
Sma3 | ionotropic glutamate receptor activity | GO:0004970 | Molecular Function | 0.0 | - |
Sma3 | extracellular-glutamate-gated ion channel activity | GO:0005234 | Molecular Function | 0.0 | - |
Sma3 | ion transport | GO:0006811 | Biological Process | 0.0 | - |
Sma3 | G-protein coupled receptor signaling pathway | GO:0007186 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | GPCR, family 3 | IPR000337 | - | 0.0 | - |
Sma3 | Ionotropic glutamate receptor | IPR001320 | - | 0.0 | - |
Sma3 | Extracellular solute-binding protein, family 3 | IPR001638 | - | 0.0 | - |
Sma3 | Extracellular ligand-binding receptor | IPR001828 | - | 0.0 | - |
Sma3 | GPCR, family 3, gamma-aminobutyric acid receptor, type B | IPR002455 | - | 0.0 | - |
Sma3 | Zinc finger, C2H2 | IPR007087 | - | 0.0 | - |
Sma3 | IPR015683 | - | 0.0 | - | |
Sma3 | Ionotropic glutamate receptor, plant | IPR017103 | - | 0.0 | - |
Sma3 | HTH domain AraC-type, conserved site | IPR018062 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G32390.3 | GLR3.5 glutamate receptor 3.5 chr2:13748468-13751908 REVERSE LENGTH=898 | 1.0e-22 | 61% |
RefSeq | Arabidopsis thaliana | NP_001031464.1 | glutamate receptor 3.5 [Arabidopsis thaliana] | 2.0e-22 | 61% |
RefSeq | Populus trichocarpa | XP_002301908.1 | glutamate-gated kainate-type ion channel receptor subunit GluR5, partial [Populus trichocarpa] | 4.0e-24 | 61% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q84W41
Fln msg: Distance to subject end: 723 aas, your sequence is shorter than subject: 66 - 903
Fln protein:
C
Protein Length:
67
Fln nts:
A
Fln Alignment:
AllPine_a_c43750___ELQILVLSFSATDPTLTSYEYPYFIRMTHSDVSQMAAIADFVSAYGWKEVVAVYINDDYGRNGI
Q84W41________________ELKIPILSFSATDPTMSPLQFPFFIRTSQNDLFQMAAIADIVQFYGWREVVAIYGDDDYGRNGV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain