|
||||||
|
UniGene Name: sp_v3.0_unigene109978
Length: 235 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene109978
T |
|
Ace file of the UniGene sp_v3.0_unigene109978
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Unassigned protein | - | - | 0.0 | - |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 62% |
| Sma3 | Putative pentatricopeptide (PPR) repeat-containing protein | - | - | 1.174e-11 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g06140; At2g01510; At2g22070; At3g05240; At3g49170; At4g02750; At5g09950; At5g19020; At5g43790; At5g48910; At5g66520; B1032F05.19; B1080A02.28; EMB2261; F2I9.13; F2K15.30; GSVIVT00000138001; GSVIVT00000282001; GSVIVT00000293001; GSVIVT00002188001; GSVI |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | ubiquitin thiolesterase activity | GO:0004221 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
| Sma3 | hydrolase activity, acting on ester bonds | GO:0016788 | Molecular Function | 0.0 | - |
| Sma3 | deaminase activity | GO:0019239 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
| Sma3 | lipid metabolic process | GO:0006629 | Biological Process | 0.0 | - |
| Sma3 | mitosis | GO:0007067 | Biological Process | 0.0 | - |
| Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
| Sma3 | purine ribonucleoside monophosphate biosynthetic process | GO:0009168 | Biological Process | 0.0 | - |
| Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G43790.1 | Pentatricopeptide repeat (PPR) superfamily protein chr5:17592099-17593481 REVERSE LENGTH=460 | 9.0e-25 | 54% |
| RefSeq | Arabidopsis thaliana | NP_199192.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 1.0e-24 | 54% |
| RefSeq | Populus trichocarpa | XP_002318526.1 | predicted protein [Populus trichocarpa] | 5.0e-27 | 63% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AB53
Fln msg: Distance to subject end: 19 aas, your sequence is shorter than subject: 77 - 232
Fln protein:
G
Protein Length:
78
Fln nts:
T
Fln Alignment:
AllPine_a_c43397___GVLSACSYAGLVNEGWHHFHSMSVVHGITATIEHYNCMVDLLGRAGCLDKAEEFVKNMPIEPNAKIWSALLGASRIH
D5AB53________________GVLSACCHAGLVSEGRQYFNSMSVDYHITPVMEHYCCMVDLLGRTGCLDEAHDFINKMPIEPDTAVWQSLLGACRTH
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
